SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
Applications | 2016 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Summary
Significance of the topic
Peptide mapping by liquid chromatography–mass spectrometry is a critical analytical tool in the biopharmaceutical industry for confirming the primary structure of monoclonal antibodies (mAbs) and monitoring post-translational or chemical modifications that impact safety and efficacy. Streamlining this workflow accelerates quality control and comparability assessments while reducing artefacts introduced during lengthy sample preparation.Study objectives and overview
This study compared the performance of the Thermo Scientific SMART Digest kit with two classic in-solution digestion protocols (urea-denaturation and heat-denaturation) for peptide mapping of the therapeutic mAb rituximab. Key metrics included sequence coverage of heavy and light chains, reproducibility, and the identification and relative quantification of critical modifications such as deamidation, oxidation, glycosylation, and carbamylation.Methodology and instrumentation
- Sample preparation: Rituximab at 2–10 mg/mL was reduced, alkylated, and digested. In-solution methods used 7 M urea or 70 °C heat for denaturation followed by trypsin overnight at 37 °C. SMART Digest used immobilized trypsin at 70 °C for 15–75 min.
- LC conditions: Thermo Scientific Vanquish Flex UHPLC with Acclaim VANQUISH C18 column (2.1 × 250 mm, 2.2 µm) at 0.3 mL/min, 50 °C, gradient from 4% to 100% organic.
- MS detection: Thermo Scientific Q Exactive HF Hybrid Quadrupole-Orbitrap with HESI-II source; full MS at 60,000 FWHM and top-5 data-dependent MS2 at 15,000 FWHM.
- Data processing: Chromeleon CDS 7.2 and BioPharma Finder 1.0 algorithms with 5 ppm mass tolerance and standard PTM search parameters.
Main results and discussion
- Sequence coverage: All six digestion conditions achieved 100% coverage of heavy and light chains. The SMART Digest protocol reached complete coverage in as little as 15 min.
- Reproducibility: SMART Digest replicates by different operators showed <5% RSD in retention times and peak areas, demonstrating robust performance.
- PTM profiling: Major N-glycoforms at N301 (A2G0F, A2G1F, A2G2F) and N-terminal pyro-glutamate formation were quantified consistently across methods. SMART Digest minimized deamidation and carbamylation artefacts compared to urea-based protocols.
- Modification factors: Heat-denatured in-solution digestion gave the highest deamidation (factor ~8.8) and oxidation (factor ~2.9). SMART Digest at 15 min showed the lowest factors (deamidation factor = 1, oxidation factor = 1) and only gradual increases at longer times.
- Peptide-level insight: Sensitive sites in peptides V306–K321 (N319) and G375–K396 (N388) were monitored by extracted ion chromatograms and isotopic shifts, confirming accurate detection of low-level deamidation.
Benefits and practical applications
- Time efficiency: Digestion time reduced from overnight to minutes without compromising data quality.
- Reduced artefacts: Elimination of urea and optimized pH minimized artificial modifications.
- High throughput: Compatibility with automated UHPLC-MS platforms supports routine QC and comparability studies.
- Standardization: The kit design ensures consistent enzyme activity and sample-to-sample reproducibility.
Future trends and possibilities
- Integration of on-line or automated digestion modules to further streamline workflows.
- Expansion to other therapeutic proteins, biosimilars, and complex biologics for comparability and stability studies.
- Advancements in high-resolution MS and data-analysis software to enable deeper characterization of low-abundance PTMs.
Conclusion
The SMART Digest kit combined with Vanquish Flex UHPLC and Q Exactive HF MS delivers a rapid, reproducible, and artefact-minimized peptide mapping workflow. It matches or exceeds classic in-solution methods in sequence coverage and PTM profiling while drastically reducing digestion time and chemical modifications.Reference
- Ren D et al. Analytical Biochemistry 2009, 392, 12–21.
- Thermo Scientific SMART Digest Kit Technical Guide, 2015.
- Thermo Scientific Application Note 21198, 2015.
- Nebija D et al. Journal of Pharmaceutical and Biomedical Analysis 2011, 56, 684–91.
- Kollipara L & Zahedi RP. Proteomics 2013, 13, 941–944.
- Dick LW et al. Journal of Chromatography B 2009, 877, 230–236.
- Visser J et al. BioDrugs 2013, 27, 495–507.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
2016|Thermo Fisher Scientific|Applications
APPLICATION NOTE Authors: Martin Samonig1, Alexander Schwahn2, Ken Cook3, Mike Oliver4, and Remco Swart1 Thermo Fisher Scientific, Germering, Germany; 2Thermo Fisher Scientific, Basel, Switzerland; 3Thermo Fisher Scientific, Hemel Hempstead, United Kingdom; 4 Thermo Fisher Scientific, Runcorn, United Kingdom 1 Key…
Key words
smart, smartdigest, digestdigestion, digestiondeamidation, deamidationurea, ureamodifications, modificationscarbamylation, carbamylationrituximab, rituximabpeptide, peptideabundance, abundancerelative, relativemodification, modificationheat, heatscientific, scientificthermo
SMART Digest Peptide Mapping and Quantitation Compendium
2018|Thermo Fisher Scientific|Guides
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Key words
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestchain, chainposttranslational, posttranslationalheavy, heavymonoclonal, monoclonaltrypsin, trypsinantibodies, antibodiesthroughput, throughputprotein, proteinautomated
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21782 Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Noemi Dorival-García, Nicola McGillicuddy, Sara Carillo, Amy Farrell, Jonathan Bones National Institute for Bioprocessing…
Key words
smart, smartdigest, digestadalimumab, adalimumabdigestion, digestionmagnetic, magneticmodifications, modificationsalternative, alternativepeptide, peptiderapid, rapiddeamidation, deamidationmapping, mappingrelative, relativenistmab, nistmabinduced, inducedsample