SMART Digest Peptide Mapping and Quantitation Compendium
Guides | 2018 | Thermo Fisher ScientificInstrumentation
Sample Preparation, Consumables, HPLC, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap, LC/IT
IndustriesPharma & Biopharma, Proteomics , Clinical Research
ManufacturerThermo Fisher Scientific
Key wordsmapping, peptide, digestion, smart, modifications, digest, chain, posttranslational, heavy, monoclonal, antibodies, trypsin, throughput, protein, automated, eeqynstyr, reproducible, proteins, chymotrypsin, infliximab, ptms, rituximab, development, nistmab, considerations, innovator, biosimilars, translational, high, analysis, comparability, maximal, investigating, classic, contents, quantitation, table, intact, characterization, workflow, reproducibility, approaches, tkpreeqynstyr, alternative, workflows, post, uhplc, product, platform, confidence
Similar PDF
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duomagnetic, magneticprime, primesrwqqgnvfscsvmhealhnhytqk
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionsequence, sequencemodifications, modificationsrelative, relativemapping, mappingscientific, scientificterminal, terminaldigest, digestptms, ptmsoptima, optimaabundance
Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21782 Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Noemi Dorival-García, Nicola McGillicuddy, Sara Carillo, Amy Farrell, Jonathan Bones National Institute for Bioprocessing…
Key words
smart, smartdigest, digestadalimumab, adalimumabdigestion, digestionmagnetic, magneticmodifications, modificationsalternative, alternativepeptide, peptiderapid, rapidmapping, mappingdeamidation, deamidationrelative, relativenistmab, nistmabinduced, inducedsample
Thermo Scientific Biopharmaceutical Characterisation Compendium
2019|Thermo Fisher Scientific|Guides
Biopharmaceutical Characterisation Compendium A complete toolbox of techniques, workflows and technologies for comprehensive biopharmaceutical characterisation Please click the circles to navigate INTRODUCTION AGGREGATE ANALYSIS CHARGE VARIANT ANALYSIS PEPTIDE MAPPING GLYCANS INTACT AND SUBUNIT ANALYSIS INTRODUCTION The resources collected in this…
Key words
mapping, mappingpeptide, peptideaggregate, aggregatevariant, variantsponsored, sponsoredglycans, glycanscharge, chargesubunit, subunitanalysis, analysisintact, intactglycan, glycanprotein, proteinmonoclonal, monoclonallinks, linksvanquish