SMART Digest Peptide Mapping and Quantitation Compendium

Guides | 2018 | Thermo Fisher ScientificInstrumentation
Sample Preparation, Consumables, HPLC, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap, LC/IT
Industries
Pharma & Biopharma, Proteomics , Clinical Research
Manufacturer
Thermo Fisher Scientific

Summary

Significance of the Topic


The development of monoclonal antibody (mAb) therapeutics demands rigorous peptide mapping to verify primary sequence and post‐translational modifications (PTMs) such as glycosylation, deamidation and oxidation.
Traditional in-solution digestion protocols require lengthy incubations and manual handling, leading to low throughput and variable results. Automated workflows using Thermo Scientific SMART Digest kits address these challenges by combining rapid proteolysis with magnetic bead-based automation for consistent, high-confidence peptide mapping.

Study Objectives and Overview


This work evaluated the performance of the SMART Digest Trypsin Kit (magnetic resin option) coupled to the KingFisher Duo Prime purification system for automated, high-throughput peptide mapping of five top-selling mAbs (chimeric, humanized and fully human).
Key metrics included sequence coverage, retention-time reproducibility, PTM identification and relative quantification of modifications.

Methodology and Instrumentation

  • Sample Preparation: mAbs diluted to 2 mg/mL, digested with immobilized trypsin at 70 °C for 45 min in SMART Digest buffer; magnetic beads recovered by automated KingFisher protocol; disulfide reduction and cysteine alkylation performed post-digest.
  • Instrumentation: Thermo Scientific KingFisher Duo Prime system for digest automation; Vanquish Flex UHPLC (Acclaim Vanquish C18, 2.2 µm, 2.1 × 250 mm) at 70 °C; Q Exactive Plus hybrid quadrupole-Orbitrap MS (Top5 dd-MS2) with BioPharma Option; data processed with BioPharma Finder.

Main Results and Discussion

  • Complete sequence coverage (100%) achieved for both heavy and light chains of all five mAbs within a 65 min LC gradient and 45 min digestion.
  • Retention-time RSD ≤ 0.14% across nine technical replicates, supporting robust UV-only QC assays.
  • Reproducible peptide area with inter-day RSD < 5%, demonstrating minimal operator-induced variability.
  • Sensitive PTM profiling: deamidation observed at selected Asn/Gln sites (0.06–7.1%), oxidation of Met/Trp residues (< 4%), N-glycan structures quantified (complex bi-antennary, high-mannose and non-human motifs), C-terminal Lys clipping (67–98% clipped) and glycation (< 1%).

Benefits and Practical Applications

  • Throughput: sample preparation reduced from overnight to < 2 h, suitable for high-volume QC and comparability studies.
  • Reproducibility: automated bead-based digestion minimizes manual steps, increasing confidence in sequence and PTM analysis.
  • Flexibility: compatible with various mAb subclasses and downstream LC-UV or LC-MS methods.
  • Regulatory support: high-precision peptide maps and PTM quantitation support lot release, stability studies and biosimilar comparability.

Future Trends and Potential Applications


Next-generation approaches will integrate multi-enzyme digestion (e.g., chymotrypsin, Lys-C) for deeper sequence coverage, immunoaffinity capture with on-bead digestion for low-abundance biomarkers, microfluidic automation and AI-driven data interpretation.
Expansion into cell-surface protein mapping, direct coupling to ion mobility separations and real-time QC dashboards will further streamline biotherapeutic analytics.

Conclusion


The automated SMART Digest magnetic workflow on the KingFisher Duo Prime, paired with Vanquish UHPLC and Q Exactive Plus MS, delivers rapid, reproducible and sensitive peptide mapping across multiple mAbs.
This end-to-end solution addresses critical needs for high-throughput QC, comprehensive PTM profiling and streamlined biopharmaceutical development.

Reference

  1. Chames P, Van Regenmortel M, Weiss E, Baty D. Therapeutic antibodies: successes, limitations and hopes for the future. Br J Pharmacol. 2009;157(2):220–233.
  2. Ecker DM, Jones SD, Levine HL. The therapeutic monoclonal antibody market. mAbs. 2015;7(1):9–14.
  3. Beck A, Wagner-Rousset E, Ayoub D, Van Dorsselaer A, Sanglier-Cianferani S. Characterization of therapeutic antibodies and related products. Anal Chem. 2013;85(2):715–736.
  4. Ren D, Pipes GD, Liu D, et al. An improved trypsin digestion method minimizes digestion-induced modifications on proteins. Anal Biochem. 2009;392(1):12–21.
  5. Rogers RS, Nightlinger NS, Livingston B, et al. Development of a quantitative mass spectrometry multi-attribute method for characterization, quality control testing and disposition of biologics. mAbs. 2015;7(5):881–890.
  6. Thermo Fisher Scientific. SMART Digest and SMART Digest ImmunoAffinity Kit Technical Guide. 2016.
  7. National Institute of Standards and Technology. NISTmAb Reference Material 8671. 2017.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Key words
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionmodifications, modificationssequence, sequencerelative, relativemapping, mappingdigest, digestscientific, scientificterminal, terminalptms, ptmsoptima, optimaabundance
Thermo Scientific Biopharmaceutical Characterisation Compendium
Biopharmaceutical Characterisation Compendium A complete toolbox of techniques, workflows and technologies for comprehensive biopharmaceutical characterisation Please click the circles to navigate INTRODUCTION AGGREGATE ANALYSIS CHARGE VARIANT ANALYSIS PEPTIDE MAPPING GLYCANS INTACT AND SUBUNIT ANALYSIS INTRODUCTION The resources collected in this…
Key words
mapping, mappingpeptide, peptideaggregate, aggregatevariant, variantglycans, glycanssponsored, sponsoredcharge, chargeanalysis, analysissubunit, subunitintact, intactglycan, glycanprotein, proteinmonoclonal, monoclonallinks, linksuhplc
Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies
APPLICATION NOTE 21782 Comparison of alternative approaches to trypsin protein digestion for reproducible and efficient peptide mapping analysis of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Noemi Dorival-García, Nicola McGillicuddy, Sara Carillo, Amy Farrell, Jonathan Bones National Institute for Bioprocessing…
Key words
smart, smartdigest, digestadalimumab, adalimumabdigestion, digestionmagnetic, magneticmodifications, modificationsalternative, alternativepeptide, peptiderapid, rapiddeamidation, deamidationmapping, mappingrelative, relativenistmab, nistmabinduced, inducedsample
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike