Comprehending COVID-19: Distinct Identification of the SARS-CoV-2 Delta Variant Using the SARS-CoV-2 LC-MS Kit (RUO)
Applications | 2021 | WatersInstrumentation
Consumables, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordsruo, wildtype, siscapa, differentiated, peptide, variants, found, impact, mutations, kit, help, waters, target, efforts, variant, thereby, selectively, delta, anti, other, concern, capture, antibodies, featured, sites, potentially, isotope, learn, affect, monitored, peptides, contains, stable, against, acquity, identified, about, detected, how, could, from, benefits, using, corporation, abstract, need, your, chromatographic, through, products
Similar PDF
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research
2021|Waters|Posters
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research Dominic Foley1, Robert Wardle1, Samantha Ferries1, Rebecca Pattison1, Jennifer Warren2, Joseph Clarke3, Lisa J Calton1 1Waters Corporation, Stamford Avenue, Altrincham Road, Wilmslow, SK9 4AX, UK, 2Waters Technologies Ireland Ltd, Wexford,…
Key words
ayn, aynnpa, npaade, adencap, ncapsiscapa, siscapavtm, vtmsil, silpeptide, peptideenrichment, enrichmentmagnetic, magneticantibody, antibodyprotein, proteinvirus, viruseluate, eluatebeads
Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO)
2021|Waters|Applications
Application Note Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO) Dominic Foley, Robert Wardle, Samantha Ferries, Rebecca Pattison, Jennifer Warren, Lisa J. Calton Waters Corporation For research use only. Not for use in diagnostic procedures. Abstract Detection and quantification of…
Key words
acquity, acquityuplc, uplcbiomarkers, biomarkersenrichment, enrichmentanti, anticlass, classncap, ncapantibodies, antibodiesxevo, xevoprognostic, prognosticsiscapa, siscaparuo, ruodowntimes, downtimesremoval, removalharmonize
SARS-CoV-2 LC-MS Workflow Overview
2021|Waters|Guides
[ QUICK REFERENCE GUIDE ] SARS-CoV-2 LC-MS Workflow Overview* The Waters™ SARS-CoV-2 LC-MS Kit (RUO) is intended for quantitative detection of SARS-CoV-2 Nucleocapsid (NCAP) peptides. This kit is for research use only and is not intended for use in diagnostic…
Key words
ruo, ruoroom, roomsuitability, suitabilitykit, kitnpa, npancap, ncaptemperature, temperaturereagent, reagentpeptide, peptideenrichment, enrichmentset, setstarter, starterincludes, includescalibrator, calibratorguide
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides