Comprehending COVID-19: Distinct Identification of the SARS-CoV-2 Delta Variant Using the SARS-CoV-2 LC-MS Kit (RUO)
Applications | 2021 | WatersInstrumentation
The emergence of the SARS-CoV-2 Delta variant has underscored the need for analytical methods that can rapidly identify and differentiate viral mutations in clinical research settings. Mass spectrometry–based peptide detection offers specificity and quantitation capabilities that complement genetic and immunological assays.
This study aimed to evaluate the performance of the SARS-CoV-2 LC-MS Kit (RUO) for capturing, detecting, and distinguishing hallmark peptides of the Delta variant in comparison to the wildtype virus and other variants of concern.
A SISCAPA workflow was applied to enrich three nucleocapsid tryptic peptides: AYNVTQAFGR, NPANNAAIVLQLPQGTTLPK, and the ADE sequence. Synthetic variants bearing D377Y, R385K, and double substitutions were spiked into viral transport medium and processed in replicate using denaturation, tryptic digestion, antibody capture, and UPLC-MS/MS analysis. MRM transitions were optimized in Skyline for selective monitoring of each peptide isoform.
Chromatographic separation and targeted MRM transitions allowed clear resolution of wildtype and variant peptides, with slight retention time shifts observed. All variant peptides were enriched by the ADE monoclonal antibody, though the double mutant showed reduced signal intensity. The method achieved reproducible detection (≤8.9% RSD) across five replicates, and the D377Y/R385K peptide remained identifiable at concentrations ≥10 amol/µL, demonstrating robust analytical sensitivity.
Mass spectrometry workflows can be extended to monitor new SARS-CoV-2 variants by updating MRM panels, integrating real-time database mining, and leveraging automation for high-throughput screening. Advances in antibody capture, instrument sensitivity, and data analysis are expected to enhance variant characterization and support public health surveillance.
The SARS-CoV-2 LC-MS Kit (RUO) effectively captures and identifies nucleocapsid peptides from the Delta variant alongside wildtype and other variants, confirming its suitability for clinical research studies focused on viral mutation tracking and quantitation.
Consumables, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Summary
Importance of the Topic
The emergence of the SARS-CoV-2 Delta variant has underscored the need for analytical methods that can rapidly identify and differentiate viral mutations in clinical research settings. Mass spectrometry–based peptide detection offers specificity and quantitation capabilities that complement genetic and immunological assays.
Objectives and Study Overview
This study aimed to evaluate the performance of the SARS-CoV-2 LC-MS Kit (RUO) for capturing, detecting, and distinguishing hallmark peptides of the Delta variant in comparison to the wildtype virus and other variants of concern.
Methodology
A SISCAPA workflow was applied to enrich three nucleocapsid tryptic peptides: AYNVTQAFGR, NPANNAAIVLQLPQGTTLPK, and the ADE sequence. Synthetic variants bearing D377Y, R385K, and double substitutions were spiked into viral transport medium and processed in replicate using denaturation, tryptic digestion, antibody capture, and UPLC-MS/MS analysis. MRM transitions were optimized in Skyline for selective monitoring of each peptide isoform.
Instrumentation
- ACQUITY UPLC I-Class PLUS System
- Xevo TQ-XS Triple Quadrupole Mass Spectrometer
- MassLynx MS Software
- TargetLynx Quantitation Software
- SARS-CoV-2 LC-MS Kit (RUO), including SISCAPA antibodies
Results and Discussion
Chromatographic separation and targeted MRM transitions allowed clear resolution of wildtype and variant peptides, with slight retention time shifts observed. All variant peptides were enriched by the ADE monoclonal antibody, though the double mutant showed reduced signal intensity. The method achieved reproducible detection (≤8.9% RSD) across five replicates, and the D377Y/R385K peptide remained identifiable at concentrations ≥10 amol/µL, demonstrating robust analytical sensitivity.
Benefits and Practical Applications
- Enables direct detection of Delta variant–associated peptides without major method modifications
- Simultaneous differentiation of multiple variants of concern via chromatographic and MRM specificity
- Quantitative performance suitable for research surveillance of emerging mutations
Future Trends and Opportunities
Mass spectrometry workflows can be extended to monitor new SARS-CoV-2 variants by updating MRM panels, integrating real-time database mining, and leveraging automation for high-throughput screening. Advances in antibody capture, instrument sensitivity, and data analysis are expected to enhance variant characterization and support public health surveillance.
Conclusion
The SARS-CoV-2 LC-MS Kit (RUO) effectively captures and identifies nucleocapsid peptides from the Delta variant alongside wildtype and other variants, confirming its suitability for clinical research studies focused on viral mutation tracking and quantitation.
References
- Foley D et al. Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO). Waters Application Note, 2021.
- GISAID database. hcov19-variants resource, accessed July 2021.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research
2021|Waters|Posters
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research Dominic Foley1, Robert Wardle1, Samantha Ferries1, Rebecca Pattison1, Jennifer Warren2, Joseph Clarke3, Lisa J Calton1 1Waters Corporation, Stamford Avenue, Altrincham Road, Wilmslow, SK9 4AX, UK, 2Waters Technologies Ireland Ltd, Wexford,…
Key words
ayn, aynnpa, npaade, adencap, ncapsiscapa, siscapavtm, vtmsil, silpeptide, peptideenrichment, enrichmentmagnetic, magneticantibody, antibodyprotein, proteinvirus, viruseluate, eluatebeads
Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO)
2021|Waters|Applications
Application Note Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO) Dominic Foley, Robert Wardle, Samantha Ferries, Rebecca Pattison, Jennifer Warren, Lisa J. Calton Waters Corporation For research use only. Not for use in diagnostic procedures. Abstract Detection and quantification of…
Key words
acquity, acquityuplc, uplcbiomarkers, biomarkersenrichment, enrichmentclass, classanti, antincap, ncapantibodies, antibodiesxevo, xevoprognostic, prognosticsiscapa, siscaparuo, ruodowntimes, downtimesremoval, removalharmonize
SARS-CoV-2 LC-MS Workflow Overview
2021|Waters|Guides
[ QUICK REFERENCE GUIDE ] SARS-CoV-2 LC-MS Workflow Overview* The Waters™ SARS-CoV-2 LC-MS Kit (RUO) is intended for quantitative detection of SARS-CoV-2 Nucleocapsid (NCAP) peptides. This kit is for research use only and is not intended for use in diagnostic…
Key words
ruo, ruoroom, roomsuitability, suitabilitykit, kitnpa, npancap, ncaptemperature, temperaturepeptide, peptidereagent, reagentenrichment, enrichmentset, setstarter, startercalibrator, calibratorincludes, includesguide
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgrgwifgttldsk, gwifgttldskadetqalpqr, adetqalpqrkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptidetime, timeratio, ratioarea, areamin, minpeptides