LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Comprehending COVID-19: Distinct Identification of the SARS-CoV-2 Delta Variant Using the SARS-CoV-2 LC-MS Kit (RUO)

Applications | 2021 | WatersInstrumentation
Consumables, LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Waters

Summary

Importance of the Topic


The emergence of the SARS-CoV-2 Delta variant has underscored the need for analytical methods that can rapidly identify and differentiate viral mutations in clinical research settings. Mass spectrometry–based peptide detection offers specificity and quantitation capabilities that complement genetic and immunological assays.

Objectives and Study Overview


This study aimed to evaluate the performance of the SARS-CoV-2 LC-MS Kit (RUO) for capturing, detecting, and distinguishing hallmark peptides of the Delta variant in comparison to the wildtype virus and other variants of concern.

Methodology


A SISCAPA workflow was applied to enrich three nucleocapsid tryptic peptides: AYNVTQAFGR, NPANNAAIVLQLPQGTTLPK, and the ADE sequence. Synthetic variants bearing D377Y, R385K, and double substitutions were spiked into viral transport medium and processed in replicate using denaturation, tryptic digestion, antibody capture, and UPLC-MS/MS analysis. MRM transitions were optimized in Skyline for selective monitoring of each peptide isoform.

Instrumentation


  • ACQUITY UPLC I-Class PLUS System
  • Xevo TQ-XS Triple Quadrupole Mass Spectrometer
  • MassLynx MS Software
  • TargetLynx Quantitation Software
  • SARS-CoV-2 LC-MS Kit (RUO), including SISCAPA antibodies

Results and Discussion


Chromatographic separation and targeted MRM transitions allowed clear resolution of wildtype and variant peptides, with slight retention time shifts observed. All variant peptides were enriched by the ADE monoclonal antibody, though the double mutant showed reduced signal intensity. The method achieved reproducible detection (≤8.9% RSD) across five replicates, and the D377Y/R385K peptide remained identifiable at concentrations ≥10 amol/µL, demonstrating robust analytical sensitivity.

Benefits and Practical Applications


  • Enables direct detection of Delta variant–associated peptides without major method modifications
  • Simultaneous differentiation of multiple variants of concern via chromatographic and MRM specificity
  • Quantitative performance suitable for research surveillance of emerging mutations

Future Trends and Opportunities


Mass spectrometry workflows can be extended to monitor new SARS-CoV-2 variants by updating MRM panels, integrating real-time database mining, and leveraging automation for high-throughput screening. Advances in antibody capture, instrument sensitivity, and data analysis are expected to enhance variant characterization and support public health surveillance.

Conclusion


The SARS-CoV-2 LC-MS Kit (RUO) effectively captures and identifies nucleocapsid peptides from the Delta variant alongside wildtype and other variants, confirming its suitability for clinical research studies focused on viral mutation tracking and quantitation.

References


  1. Foley D et al. Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO). Waters Application Note, 2021.
  2. GISAID database. hcov19-variants resource, accessed July 2021.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research Dominic Foley1, Robert Wardle1, Samantha Ferries1, Rebecca Pattison1, Jennifer Warren2, Joseph Clarke3, Lisa J Calton1 1Waters Corporation, Stamford Avenue, Altrincham Road, Wilmslow, SK9 4AX, UK, 2Waters Technologies Ireland Ltd, Wexford,…
Key words
ayn, aynnpa, npaade, adencap, ncapsiscapa, siscapavtm, vtmsil, silpeptide, peptideenrichment, enrichmentmagnetic, magneticantibody, antibodyprotein, proteinvirus, viruseluate, eluatebeads
Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO)
Application Note Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO) Dominic Foley, Robert Wardle, Samantha Ferries, Rebecca Pattison, Jennifer Warren, Lisa J. Calton Waters Corporation For research use only. Not for use in diagnostic procedures. Abstract Detection and quantification of…
Key words
acquity, acquitybiomarkers, biomarkersuplc, uplcenrichment, enrichmentclass, classanti, antincap, ncapantibodies, antibodiesxevo, xevoprognostic, prognosticsiscapa, siscaparuo, ruodowntimes, downtimesremoval, removalharmonize
SARS-CoV-2 LC-MS Workflow Overview
[ QUICK REFERENCE GUIDE ] SARS-CoV-2 LC-MS Workflow Overview* The Waters™ SARS-CoV-2 LC-MS Kit (RUO) is intended for quantitative detection of SARS-CoV-2 Nucleocapsid (NCAP) peptides. This kit is for research use only and is not intended for use in diagnostic…
Key words
ruo, ruoroom, roomsuitability, suitabilitykit, kitncap, ncapnpa, npatemperature, temperaturepeptide, peptidereagent, reagentenrichment, enrichmentset, setstarter, startercalibrator, calibratorincludes, includesguide
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
Other projects
GCMS
ICPMS
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike