A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2

Applications | 2021 | Thermo Fisher ScientificInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Thermo Fisher Scientific

Summary

Significance of the Topic


The COVID-19 pandemic has highlighted the need for rapid, reliable, and orthogonal diagnostic methods complementing RT-PCR. Mass spectrometry–based peptide quantitation offers direct detection of viral proteins, potential viral load assessment, and adaptability to emerging variants.

Aims and Study Overview


This study aimed to develop and validate a four-minute, bottom-up LC-MS/MS assay on a TSQ Altis MD system to detect and absolutely quantify six signature peptides from the SARS-CoV-2 spike and nucleocapsid proteins in nasopharyngeal swab and saliva matrices.

Methodology


Samples of recombinant spike (P0DTC2) and nucleocapsid (P0DTC9) proteins were spiked into pooled nasal fluids or saliva and stored in viral transport medium. Proteins were precipitated with cold acetone, digested with SMART Digest trypsin, and diluted for LC-MS/MS analysis. Selected reaction monitoring targeted six proteotypic peptides, using stable isotope–labeled internal standards for retention time confirmation and quantification. Calibration ranges spanned 0.01–100 fmol on column.

Used Instrumentation


  • Thermo Scientific TSQ Altis MD triple-quadrupole mass spectrometer
  • Thermo Scientific Vanquish MD UHPLC system
  • Hypersil GOLD C18 column (2.1 × 50 mm, 1.9 μm)
  • Thermo Scientific SMART Digest Trypsin Kit
  • TraceFinder LDT software for data processing

Main Results and Discussion


The assay achieved limits of detection of 0.25–5 fmol and quantitation limits of 0.5–10 fmol on column across both matrices, with R² values >0.99 and CV/RSD <15%. Peptides from both nucleocapsid and spike proteins exhibited consistent retention times (<±0.01 min), robust linearity, and clear differentiation by mass transitions, enabling reliable identification and quantitation.

Benefits and Practical Applications


  • High throughput: 4-minute run time per sample
  • Absolute quantitation supports viral load estimation
  • Dual-protein targeting reduces false positives
  • Automatable data processing for rapid reporting

Future Trends and Applications


The workflow can expand into multiplexed panels for respiratory pathogens (e.g., influenza, RSV) or track variant-specific peptides. Further validation against clinical PCR results and exploration of simplified sample prep could enhance scalability in diagnostic laboratories.

Conclusion


This targeted LC-MS/MS method provides a fast, accurate, and reproducible approach for SARS-CoV-2 protein detection in clinical matrices. Its sensitivity, specificity, and adaptability position it as a valuable complement to existing molecular diagnostics.

Reference


1. Cardozo K. et al. Nat Commun. 2020;11:6201.
2. He J. et al. Respir Med. 2020;168:105980.
3. Johansson M. et al. JAMA Netw Open. 2021;4(1):e2035057.
4. Bankar R. et al. Cell Reports. 2021;24(3):102135.
5. CDC. SARS-CoV-2 Variant Classifications.
6. Korber B. et al. Cell. 2020;182(4):812–827.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2 Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Sarvesh Iyer1, Yang Pengxiang1, Luan Shen1, Bradley J. Hart1 1. Thermo Fisher Scientific, San Jose,…
Key words
fmol, fmolcovid, covidpeptides, peptidesnpannaaivl, npannaaivlqlpqgttlpk, qlpqgttlpkkadetqalpqr, kadetqalpqrpeptide, peptidenucleocapsid, nucleocapsidadetqalpqr, adetqalpqrnasal, nasalaltis, altisproteins, proteinsaynvyqafgr, aynvyqafgrgwifgt, gwifgttldsk
Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2
Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2 Richard J. Gibson, Stephanie N. Samra, Yvonne E. Song, Jingshu Guo. Thermo Fisher Scientific, San Jose, CA ABSTRACT RESULTS Purpose: Demonstrate that peptide enrichment can enhance…
Key words
kadetqalpqr, kadetqalpqraynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrpeptide, peptidethermo, thermodgiiwvategal, dgiiwvategallpqgttlpk, lpqgttlpknpannaaivlq, npannaaivlqnpannaaivlql, npannaaivlqlntpk, ntpkpqgttlpk, pqgttlpkdgiiwvate, dgiiwvategalntpk, galntpkenrichment, enrichmentnpannaaivlqlpqgttlpk
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolpeptide, peptideviral, viralproteins, proteinsllod, llodcoronavirus, coronavirusquantification, quantificationtargeted, targetedpeptides, peptideshealthy, healthypooled
LC-MS for detection of SARS-CoV-2 viral and host proteins
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptidetargeted, targetedclinicians, cliniciansnstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkarea, areapeptides
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike