A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
Applications | 2021 | Thermo Fisher ScientificInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Key wordsaynvtqafgr, adetqalpqr, gwifgttldsk, kadetqalpqr, dgiiwvategalntpk, npannaaivlqlpqgttlpk, retention, intensity, fmol, peptide, ratio, time, area, min, peptides, protein, saliva, siss, nasopharyngeal, digest, mass, smart, pcr, femtomole, each, swabs, equal, srm, infections, proteolytic, minutes, nps, altis, absolute, isotope, labeled, detection, quantification, thermo, rna, samples, proteins, concentration, scientific, sequence, collection, loqs, dgiiwvat, egalntpk, pandemics
Similar PDF
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Posters
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2 Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Sarvesh Iyer1, Yang Pengxiang1, Luan Shen1, Bradley J. Hart1 1. Thermo Fisher Scientific, San Jose,…
Key words
fmol, fmolcovid, covidpeptides, peptidesnpannaaivl, npannaaivlqlpqgttlpk, qlpqgttlpkkadetqalpqr, kadetqalpqrpeptide, peptidenucleocapsid, nucleocapsidadetqalpqr, adetqalpqrnasal, nasalaltis, altisproteins, proteinsaynvyqafgr, aynvyqafgrgwifgt, gwifgttldsk
ASMS: Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2
2022|Thermo Fisher Scientific|Posters
Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2 Richard J. Gibson, Stephanie N. Samra, Yvonne E. Song, Jingshu Guo. Thermo Fisher Scientific, San Jose, CA ABSTRACT RESULTS Purpose: Demonstrate that peptide enrichment can enhance…
Key words
kadetqalpqr, kadetqalpqraynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrpeptide, peptidethermo, thermodgiiwvategal, dgiiwvategallpqgttlpk, lpqgttlpknpannaaivlq, npannaaivlqnpannaaivlql, npannaaivlqlntpk, ntpkpqgttlpk, pqgttlpkdgiiwvate, dgiiwvategalntpk, galntpkenrichment, enrichmentnpannaaivlqlpqgttlpk
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
2020|SCIEX|Applications
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolviral, viralpeptide, peptideproteins, proteinsquantification, quantificationllod, llodcoronavirus, coronavirustargeted, targetedhealthy, healthypeptides, peptidesdilution
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptidetargeted, targetedclinicians, cliniciansnstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkarea, areapeptides