Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2
Posters | 2021 | Thermo Fisher Scientific | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Key wordsfmol, covid, peptides, npannaaivl, qlpqgttlpk, kadetqalpqr, peptide, adetqalpqr, nucleocapsid, nasal, altis, proteins, aynvyqafgr, gwifgt, tldsk, dgiiwvate, galntpk, gwifgttldsk, tsq, numerous, dgiiwvategalntpk, aynvtqafgr, backlog, lod, cmd, loq, samples, mass, retention, saliva, polymerase, unlabeled, minutes, respiratory, copies, acute, could, members, inconsistent, thermo, from, pcr, acknowledge, variance, vertical, were, infringe, country, recombinant, severe
Similar PDF
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2
2022|Thermo Fisher Scientific|Posters
Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2 Richard J. Gibson, Stephanie N. Samra, Yvonne E. Song, Jingshu Guo. Thermo Fisher Scientific, San Jose, CA ABSTRACT RESULTS Purpose: Demonstrate that peptide enrichment can enhance…
Key words
kadetqalpqr, kadetqalpqraynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrpeptide, peptidethermo, thermodgiiwvategal, dgiiwvategallpqgttlpk, lpqgttlpknpannaaivlq, npannaaivlqnpannaaivlql, npannaaivlqlntpk, ntpkpqgttlpk, pqgttlpkdgiiwvate, dgiiwvategalntpk, galntpkenrichment, enrichmentnpannaaivlqlpqgttlpk
Rapid Simultaneous Detection of Respiratory Infectious Diseases using Immunoprecipitation and Liquid Chromatography-Tandem Mass Spectrometry
2022|Thermo Fisher Scientific|Posters
Rapid Simultaneous Detection of Respiratory Infectious Diseases using Immunoprecipitation and Liquid Chromatography-Tandem Mass Spectrometry Yvonne E. Song, Richard J. Gibson, and Stephanie N. Samra, Thermo Fisher Scientific, 355 River Oaks Parkway, San Jose, CA, USA, 95134 Table 3. List of…
Key words
infectious, infectiousfmol, fmolinfluenza, influenzaavaaalk, avaaalkdqllsssk, dqllssskegyslvgidpfk, egyslvgidpfkfleelnaftr, fleelnaftrgfyaegsr, gfyaegsrgggtlvaeair, gggtlvaeairgvfelsdek, gvfelsdeklnqlesk, lnqlesknqdlydaak, nqdlydaaksalilr, salilrtiyfspir, tiyfspirsil
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptidetargeted, targetedclinicians, cliniciansnstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkarea, areacovid