Rapid Simultaneous Detection of Respiratory Infectious Diseases using Immunoprecipitation and Liquid Chromatography-Tandem Mass Spectrometry
Posters | 2022 | Thermo Fisher Scientific | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Key wordsinfectious, fmol, influenza, avaaalk, dqllsssk, egyslvgidpfk, fleelnaftr, gfyaegsr, gggtlvaeair, gvfelsdek, lnqlesk, nqdlydaak, salilr, tiyfspir, sil, adetqalpqr, peptide, rsv, disease, respiratory, arb, time, peptides, min, endogenous, srm, temp, immunoprecipitation, gas, sec, sequence, retention, simultaneous, different, mtorr, viral, column, enrich, virus, divert, thermo, recovery, excluded, diseases, severe, mobile, parameters, vaporizer, source, eliminated
Similar PDF
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensitypeptide, peptidefmol, fmoltime, timeratio, ratioarea, areamin, minpeptides
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Posters
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2 Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Sarvesh Iyer1, Yang Pengxiang1, Luan Shen1, Bradley J. Hart1 1. Thermo Fisher Scientific, San Jose,…
Key words
fmol, fmolcovid, covidpeptides, peptidesnpannaaivl, npannaaivlqlpqgttlpk, qlpqgttlpkkadetqalpqr, kadetqalpqrpeptide, peptidenucleocapsid, nucleocapsidadetqalpqr, adetqalpqrnasal, nasalaltis, altisproteins, proteinsaynvyqafgr, aynvyqafgrgwifgt, gwifgttldsk
Protein sample preparation and quantitation for mass spectrometry
2017|Thermo Fisher Scientific|Guides
Protein sample preparation and quantitation for mass spectrometry Reagents, consumables, instrumentation, and software for proteomics research Contents Introduction 4 Workflows 8 Protein sample preparation Introduction Sample lysis and protein extraction Pierce Mass Spec Sample Prep Kit for Cultured…
Key words
protein, proteinpierce, piercepeptide, peptideproteins, proteinsspin, spinpeptides, peptideskit, kitenrichment, enrichmentthermo, thermoquantitation, quantitationdigestion, digestionscientific, scientificyes, yesmass, masssample
An urgent need for expanded virus research
2020|Thermo Fisher Scientific|Technical notes
WHITE PAPER 65880 An urgent need for expanded virus research The role of mass spectrometry in understanding virus structure and function If we needed any additional evidence that virus research is an important area to emphasize, the severe acute respiratory…
Key words
virus, virusviral, viralprotein, proteinhost, hostimmune, immuneinteractions, interactionsproteins, proteinsmhc, mhchdx, hdxglycosylation, glycosylationvaccine, vaccinepeptides, peptidesstructural, structuralmembrane, membranecell