LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2

Posters | 2022 | Thermo Fisher Scientific | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Thermo Fisher Scientific

Summary

Significance of the Topic


This study addresses the urgent need for reliable measurement of SARS-CoV-2 proteins in clinical specimens. Absolute quantitation of viral biomarkers in nasal fluids supports diagnostic assay development, epidemiological monitoring and evaluation of viral load, offering an orthogonal approach to nucleic acid tests.

Objectives and Study Overview


The primary goal was to demonstrate that integrating peptide enrichment into a liquid chromatography–mass spectrometry (LC-MS) workflow enhances sensitivity and throughput for measuring SARS-CoV-2 nucleocapsid protein. Recombinant protein spiked into pooled nasal fluids was used to validate method performance.

Methodology and Instrumentation


Sample preparation included protein precipitation, enzymatic digestion with a SMART Digest™ trypsin kit, and peptide enrichment via SISCAPA using anti-peptide antibodies. Stable isotope-labeled standards (SIS) for each target peptide enabled absolute quantitation and compensation for matrix effects. Separation was achieved on a Hypersil GOLD™ C18 column (2.1×50 mm, 1.9 µm) with a 2-minute gradient. Detection employed a Thermo Scientific™ TSQ Altis™ mass spectrometer operating in selected reaction monitoring (SRM) mode. Data analysis used TraceFinder™ LDT software.

Main Results and Discussion


  • Limits of detection ranged from 0.25 to 1.0 fmol on-column; limits of quantitation from 0.25 to 2.5 fmol.
  • Calibration curves for five peptides showed linearity with R2 > 0.99 across 0.25–100 fmol.
  • Precision was within 15% relative standard deviation across the analytical measurement range.
  • Chromatographic peaks were well resolved, with retention time variability below ±0.01 minutes.
  • Peptide enrichment reduced background interference and enabled 2-minute LC runs, with each peptide eluting within a 30-second window.

Benefits and Practical Applications


The addition of SISCAPA enrichment significantly improves assay sensitivity, reduces total analysis time and lowers the required sample volume. This approach can be deployed in clinical and research laboratories for high-throughput quantitation of viral proteins, supporting COVID-19 diagnostics, vaccine evaluation and variant surveillance.

Future Trends and Opportunities


Further developments may include multiplexed panels targeting multiple viral proteins or host response markers, integration with automated sample handling for large-scale screening, and adaptation to point-of-care platforms. Advances in high-resolution MS and improved antibody reagents will drive even greater sensitivity and specificity.

Conclusion


Incorporating peptide enrichment into an LC-MS workflow enables robust, high-throughput absolute quantitation of SARS-CoV-2 proteins in nasal fluids, with low femtomole sensitivity and rapid analysis times. This method holds promise for enhancing clinical diagnostics and virological research.

References


  1. Coronavirus in the US: Latest Map and Case Count: www.nytimes.com/interactive/2020/us/coronavirus-us-cases.html
  2. He J. et al. Diagnostic Performance Between CT and Initial Real-Time RT-PCR for Clinically Suspected 2019 Coronavirus Disease (COVID-19) Patients Outside Wuhan, China. Respir Med. 2020;168:105980.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptidetime, timeratio, ratioarea, areamin, minpeptides
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2 Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Sarvesh Iyer1, Yang Pengxiang1, Luan Shen1, Bradley J. Hart1 1. Thermo Fisher Scientific, San Jose,…
Key words
fmol, fmolcovid, covidpeptides, peptidesnpannaaivl, npannaaivlqlpqgttlpk, qlpqgttlpkkadetqalpqr, kadetqalpqrpeptide, peptidenucleocapsid, nucleocapsidadetqalpqr, adetqalpqrnasal, nasalaltis, altisproteins, proteinsaynvyqafgr, aynvyqafgrgwifgt, gwifgttldsk
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research Dominic Foley1, Robert Wardle1, Samantha Ferries1, Rebecca Pattison1, Jennifer Warren2, Joseph Clarke3, Lisa J Calton1 1Waters Corporation, Stamford Avenue, Altrincham Road, Wilmslow, SK9 4AX, UK, 2Waters Technologies Ireland Ltd, Wexford,…
Key words
ayn, aynnpa, npaade, adencap, ncapsiscapa, siscapavtm, vtmsil, silpeptide, peptideenrichment, enrichmentmagnetic, magneticantibody, antibodyprotein, proteinvirus, viruseluate, eluatebeads
SARS-CoV-2 LC-MS Workflow Overview
[ QUICK REFERENCE GUIDE ] SARS-CoV-2 LC-MS Workflow Overview* The Waters™ SARS-CoV-2 LC-MS Kit (RUO) is intended for quantitative detection of SARS-CoV-2 Nucleocapsid (NCAP) peptides. This kit is for research use only and is not intended for use in diagnostic…
Key words
ruo, ruoroom, roomsuitability, suitabilitykit, kitnpa, npancap, ncaptemperature, temperaturereagent, reagentpeptide, peptideenrichment, enrichmentset, setstarter, startercalibrator, calibratorincludes, includesguide
Other projects
GCMS
ICPMS
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike