Including peptide enrichment in a mass spectrometry-based workflow for the absolute quantitation of SARS-CoV-2
Posters | 2022 | Thermo Fisher Scientific | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Key wordskadetqalpqr, aynvtqafgr, adetqalpqr, peptide, thermo, dgiiwvategal, lpqgttlpk, npannaaivlq, npannaaivlql, ntpk, pqgttlpk, dgiiwvate, galntpk, enrichment, npannaaivlqlpqgttlpk, dgiiwvategalntpk, scientific, sequence, sis, altis, members, marketing, incorporation, acknowledge, intellectual, variance, country, rights, infringe, triplicate, licensing, retention, property, tsq, assays, each, manner, depends, vanquish, absolute, acknowledgements, might, assay, presented, all, lod, minimal, existing, regulatory, peptides
Similar PDF
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Posters
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2 Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Sarvesh Iyer1, Yang Pengxiang1, Luan Shen1, Bradley J. Hart1 1. Thermo Fisher Scientific, San Jose,…
Key words
fmol, fmolcovid, covidpeptides, peptidesnpannaaivl, npannaaivlqlpqgttlpk, qlpqgttlpkkadetqalpqr, kadetqalpqrpeptide, peptideadetqalpqr, adetqalpqrnucleocapsid, nucleocapsidnasal, nasalaltis, altisproteins, proteinsaynvyqafgr, aynvyqafgrgwifgt, gwifgttldsk
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research
2021|Waters|Posters
Analysis of SARS-CoV-2 using LC-MS Peptide Enrichment for Clinical Research Dominic Foley1, Robert Wardle1, Samantha Ferries1, Rebecca Pattison1, Jennifer Warren2, Joseph Clarke3, Lisa J Calton1 1Waters Corporation, Stamford Avenue, Altrincham Road, Wilmslow, SK9 4AX, UK, 2Waters Technologies Ireland Ltd, Wexford,…
Key words
ayn, aynnpa, npaade, adencap, ncapsiscapa, siscapavtm, vtmsil, silpeptide, peptideenrichment, enrichmentmagnetic, magneticantibody, antibodyprotein, proteinvirus, viruseluate, eluatebeads
SARS-CoV-2 LC-MS Workflow Overview
2021|Waters|Guides
[ QUICK REFERENCE GUIDE ] SARS-CoV-2 LC-MS Workflow Overview* The Waters™ SARS-CoV-2 LC-MS Kit (RUO) is intended for quantitative detection of SARS-CoV-2 Nucleocapsid (NCAP) peptides. This kit is for research use only and is not intended for use in diagnostic…
Key words
ruo, ruoroom, roomsuitability, suitabilitykit, kitncap, ncapnpa, npatemperature, temperaturepeptide, peptidereagent, reagentenrichment, enrichmentset, setstarter, startercalibrator, calibratorincludes, includesguide