LC-MS for detection of SARS-CoV-2 viral and host proteins
Applications | 2021 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap, LC/QQQ
IndustriesClinical Research
ManufacturerThermo Fisher Scientific
Key wordssevere, swab, viral, nasopharyngeal, proteins, host, peptide, clinicians, targeted, nstpgssr, fgg, srm, dgiiwvategalntpk, peptides, covid, area, altis, differentially, peak, maxquant, plasma, samples, non, were, mass, dfmslseqlr, dghvetfypk, dgiiwvategalntp, ellqngmngr, flpfqqfgr, iqdslsstasalgk, ngsihlyfdk, ntqevfaqvk, qiapgqtgk, synthetic, based, respiratory, expressed, tsq, protein, fedgvldpdypr, retention, proteomics, time, prognostic, from, proteome, load, biomarkers, performed
Similar PDF
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Posters
Developing a Quick and Robust Mass Spectrometry-based Method for the Detection of SARS-CoV-2 Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Sarvesh Iyer1, Yang Pengxiang1, Luan Shen1, Bradley J. Hart1 1. Thermo Fisher Scientific, San Jose,…
Key words
fmol, fmolcovid, covidpeptides, peptidesnpannaaivl, npannaaivlqlpqgttlpk, qlpqgttlpkkadetqalpqr, kadetqalpqrpeptide, peptidenucleocapsid, nucleocapsidadetqalpqr, adetqalpqrnasal, nasalaltis, altisproteins, proteinsaynvyqafgr, aynvyqafgrgwifgt, gwifgttldsk
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
2020|SCIEX|Applications
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolviral, viralpeptide, peptideproteins, proteinsllod, llodquantification, quantificationcoronavirus, coronavirustargeted, targetedpeptides, peptideshealthy, healthyrecombinant
To gain new biological insights - Virus research solutions
2022|Thermo Fisher Scientific|Brochures and specifications
Go beyond To gain new biological insights Virus research solutions An urgent need for expanded virus research Harness the power of omics to accelerate virus research. Thermo Fisher Scientific’s proteomics, glycomics, lipidomics and metabolomics mass spectrometry workflows provide virus researchers…
Key words
thermo, thermovirus, virusscientific, scientificviral, viralneo, neosoftware, softwarevanquish, vanquishinsights, insightsdiscoverer, discovereruhplc, uhplcproteome, proteomeorbitrap, orbitraptmt, tmtprotein, proteineasypep