LC-MS for detection of SARS-CoV-2 viral and host proteins

Applications | 2021 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap, LC/QQQ
Industries
Clinical Research
Manufacturer
Thermo Fisher Scientific

Summary

Significance of the Topic


This study addresses the need for complementary methods to RT-PCR and antigen tests in COVID-19 diagnosis and prognosis.
Mass spectrometry offers high specificity for detecting viral proteins and quantifying host response markers, supporting clinical decisions on disease severity and progression.

Objectives and Study Overview


The primary aim was to develop and validate a robust LC-MS workflow for targeted detection of SARS-CoV-2 peptides and host protein surrogates in nasopharyngeal swab and plasma samples.
The study compared non-severe and severe COVID-19 cohorts to identify prognostic biomarkers and assess correlation with viral load.

Methodology and Instrumentation


Sample Preparation and Discovery Proteomics
  • Plasma: depletion of abundant proteins, reduction/alkylation, trypsin digestion.
  • Swabs: heat inactivation, organic solvent precipitation, digestion.
  • Desalting via C18 cleanup.

Chromatography and Mass Spectrometry
  • Discovery: EASY-nLC 1200 coupled to Orbitrap Fusion Lumos (HRAM) in data-dependent mode.
  • Targeted SRM: Vanquish Flex UHPLC and TSQ Altis triple quadrupole using optimized gradients on Hypersil GOLD C18 columns.

Instrument List


  • Thermo Scientific Orbitrap Fusion Lumos Tribrid MS
  • Thermo Scientific TSQ Altis Triple Quadrupole MS
  • Thermo Scientific Vanquish Flex Quaternary UHPLC
  • Thermo Scientific EASY-nLC 1200 nanoLC system

Key Findings and Discussion


Plasma Proteome
  • Label-free quantification detected ~1,200 proteins; 38 showed significant changes between severe and non-severe groups.
  • Up-regulated in severe cases: fibrinogen gamma chain (FGG), SERPINA4, Serum amyloid P-component (APCS), S100A8.
  • Down-regulated: complement factors D and C8A, CD14.
  • Targeted SRM validated overexpression of host markers (e.g., angiotensinogen, apolipoprotein B) with synthetic heavy peptide controls ensuring run consistency.

Swab Proteome and Viral Peptides
  • Shotgun analysis on pooled solvents maximized viral peptide coverage.
  • MRM assays monitored 11 peptides from nucleoprotein, spike glycoprotein, and replicase polyprotein 1ab.
  • Distinct elution profiles allowed sensitive discrimination of COVID-19 positive and negative samples.
  • Host inflammation markers (LDH, IL-6, CRP) also detected in swabs, correlating with disease status.

Benefits and Practical Applications


  • Provides orthogonal confirmation to RT-PCR, reducing false results.
  • Quantitative readout of viral load and host response enables severity assessment.
  • Multiplexed assay can be implemented on existing high-flow LC-MS platforms for clinical research.

Future Trends and Potential Applications


  • Expansion to larger, diverse cohorts with blinded validation.
  • Development of simplified, high-throughput SRM panels for point-of-care research labs.
  • Integration into multi-omics pipelines to monitor emerging variants and host pathways.
  • Application to other respiratory pathogens using similar proteomic workflows.

Conclusion


Combining discovery and targeted LC-MS approaches enabled sensitive detection of SARS-CoV-2 peptides and host prognostic markers in swab and plasma samples.
The workflow demonstrates potential for clinical research applications in diagnosis, severity monitoring, and biomarker discovery beyond conventional methods.

References


1. Tang Y, Schmitz JE, Persing DH, Stratton CW. Laboratory Diagnosis of COVID-19: Current Issues and Challenges. J Clin Microbiol. 2020;58(6):e00512-20.
2. Preprint: COVID-19 plasma deep proteome reveals distinct signatures in severe patients. Research Square. 2021.
3. Ponnusamy D, et al. Proteomic investigation reveals dominant alterations of neutrophil degranulation and mRNA translation pathways in COVID-19 patients. PLoS ONE. 2020;15(11):e0240012.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgrgwifgttldsk, gwifgttldskadetqalpqr, adetqalpqrkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptidetime, timeratio, ratioarea, areamin, minpeptides
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolviral, viralpeptide, peptideproteins, proteinsllod, llodcoronavirus, coronavirusquantification, quantificationtargeted, targetedpeptides, peptideshealthy, healthypooled
To gain new biological insights - Virus research solutions
To gain new biological insights - Virus research solutions
2022|Thermo Fisher Scientific|Brochures and specifications
Go beyond To gain new biological insights Virus research solutions An urgent need for expanded virus research Harness the power of omics to accelerate virus research. Thermo Fisher Scientific’s proteomics, glycomics, lipidomics and metabolomics mass spectrometry workflows provide virus researchers…
Key words
thermo, thermovirus, virusscientific, scientificviral, viralneo, neosoftware, softwarevanquish, vanquishuhplc, uhplcdiscoverer, discovererinsights, insightsorbitrap, orbitrapproteome, proteometmt, tmtprotein, proteineasypep
Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis
Application Note Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis Laurence Van Oudenhove, Jan Claereboudt, Rowan Moore, Hans Vissers, Bart Van Puyvelde, Simon Daled, Dieter Deforce, Katleen Van Uytfanghe, Steve Silvester, Sally Hannam, Donald…
Key words
mrm, mrmcov, covxevo, xevospike, spikepeptide, peptideacquity, acquitymasslynx, masslynxgupta, guptaleong, leonggeest, geestaverage, averageamount, amountresponse, responselevels, levelscoronavirus
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike