Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis
Applications | 2020 | WatersInstrumentation
Accurate and rapid detection of SARS-CoV-2 proteins in clinical samples is crucial for enhancing diagnostic strategies beyond nucleic acid testing. Targeted LC-MS methods offer specificity, quantitative capability, and complement existing PCR workflows by directly measuring viral proteins in complex matrices.
This study aimed to develop an optimized multiple reaction monitoring (MRM) LC-MS workflow that maximizes dynamic range and reproducibility for detecting two key SARS-CoV-2 proteins—Spike glycoprotein and Nucleoprotein—in nasopharyngeal swab samples preserved in universal transport medium (UTM). The approach focused on surrogate peptide quantitation, consumable selection, and transition optimization.
Samples of recombinant Spike and Nucleoprotein were digested, spiked into blank UTM matrix, and processed following a community-based standard operating procedure. Key steps included:
The method delivered baseline chromatographic peaks within a 5.5 min window and total cycle time under 9 min. Linearity was demonstrated across five spike levels for both target peptides with R² ≥ 0.998 and residuals < 15%. Consumable optimizations produced incremental signal gains: vial selection (+15%), solvent composition (+20%), and column chemistry (+10%), yielding an overall ~55% increase in MRM response. Matrix interference limited LLOD; removal of UTM improved sensitivity, suggesting cleaner sample preparation could further extend detection limits.
Further improvements may include advanced clean-up or enrichment techniques to reduce matrix effects, adoption of alternative swab media, and expansion to multiplexed assays for simultaneous detection of multiple pathogens. Integration with automated workflows and miniaturized LC-MS platforms could support point-of-care testing.
This optimized MRM-based LC-MS method delivers rapid, reproducible, and sensitive quantitation of SARS-CoV-2 proteins in clinical swab samples. Strategic selection of consumables, careful transition design, and robust instrumentation enable a broad dynamic range and high throughput, supporting its use in research and potential diagnostic workflows.
1. Parks JM, Smith JC. How to Discover Antiviral Drugs Quickly. N Engl J Med. 2020;382(23):2261–2264.
2. Bezstarosti K, Lamers MM, Haagmans BL, Demmers JAA. Targeted Proteomics for the Detection of SARS-CoV-2 Proteins. bioRxiv. 2020. doi:10.1101/2020.04.23.057810v1
3. Surjit M, Lal SK. The Nucleocapsid Protein of the SARS Coronavirus: Structure, Function and Therapeutic Potential. Molecular Biology of the SARS-Coronavirus. 2009;129–151.
4. Dhaenens M, et al. A Universally Adoptable Corona Multiple Reaction Monitoring Assay. Genesis UGhent. 2020.
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Summary
Significance of the Topic
Accurate and rapid detection of SARS-CoV-2 proteins in clinical samples is crucial for enhancing diagnostic strategies beyond nucleic acid testing. Targeted LC-MS methods offer specificity, quantitative capability, and complement existing PCR workflows by directly measuring viral proteins in complex matrices.
Objectives and Study Overview
This study aimed to develop an optimized multiple reaction monitoring (MRM) LC-MS workflow that maximizes dynamic range and reproducibility for detecting two key SARS-CoV-2 proteins—Spike glycoprotein and Nucleoprotein—in nasopharyngeal swab samples preserved in universal transport medium (UTM). The approach focused on surrogate peptide quantitation, consumable selection, and transition optimization.
Methodology and Instrumentation
Samples of recombinant Spike and Nucleoprotein were digested, spiked into blank UTM matrix, and processed following a community-based standard operating procedure. Key steps included:
- Reconstitution of digests in optimized solvent compositions
- Chromatographic separation on C18 reverse-phase column at 40°C
- MRM acquisition with two transitions per peptide to balance sensitivity and duty cycle
Used Instrumentation
- Waters ACQUITY UPLC I-Class PLUS System
- Xevo TQ-XS Tandem Quadrupole Mass Spectrometer
- QuanRecovery vials with MaxPeak HPS
- ACQUITY PREMIER Peptide BEH C18 300 Å, 2.1×50 mm, 1.7 μm column
- Data processing via MassLynx, TargetLynx, and Skyline software
Main Results and Discussion
The method delivered baseline chromatographic peaks within a 5.5 min window and total cycle time under 9 min. Linearity was demonstrated across five spike levels for both target peptides with R² ≥ 0.998 and residuals < 15%. Consumable optimizations produced incremental signal gains: vial selection (+15%), solvent composition (+20%), and column chemistry (+10%), yielding an overall ~55% increase in MRM response. Matrix interference limited LLOD; removal of UTM improved sensitivity, suggesting cleaner sample preparation could further extend detection limits.
Benefits and Practical Applications
- High throughput: sub-9 min cycle time suitable for large-scale screening
- Robust quantitation: excellent reproducibility across dynamic range
- Enhanced sensitivity through optimized consumables and transitions
- Direct measurement of viral proteins as complementary diagnostic data
Future Trends and Potential Applications
Further improvements may include advanced clean-up or enrichment techniques to reduce matrix effects, adoption of alternative swab media, and expansion to multiplexed assays for simultaneous detection of multiple pathogens. Integration with automated workflows and miniaturized LC-MS platforms could support point-of-care testing.
Conclusion
This optimized MRM-based LC-MS method delivers rapid, reproducible, and sensitive quantitation of SARS-CoV-2 proteins in clinical swab samples. Strategic selection of consumables, careful transition design, and robust instrumentation enable a broad dynamic range and high throughput, supporting its use in research and potential diagnostic workflows.
References
1. Parks JM, Smith JC. How to Discover Antiviral Drugs Quickly. N Engl J Med. 2020;382(23):2261–2264.
2. Bezstarosti K, Lamers MM, Haagmans BL, Demmers JAA. Targeted Proteomics for the Detection of SARS-CoV-2 Proteins. bioRxiv. 2020. doi:10.1101/2020.04.23.057810v1
3. Surjit M, Lal SK. The Nucleocapsid Protein of the SARS Coronavirus: Structure, Function and Therapeutic Potential. Molecular Biology of the SARS-Coronavirus. 2009;129–151.
4. Dhaenens M, et al. A Universally Adoptable Corona Multiple Reaction Monitoring Assay. Genesis UGhent. 2020.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARS-CoV-2 Proteins
2020|Waters|Applications
Application Note Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARSCoV-2 Proteins Stuart Oehrle, Laurence Van Oudenhove, Jan Claereboudt, Hans Vissers, Bart Van Puyvelde, Simon Daled, Katleen Van Uytfanghe, Dieter Deforce, Maarten Dhaenens For…
Key words
unispray, unisprayncap, ncappeptide, peptideelectrospray, electrospraypeptides, peptidesionization, ionizationutm, utmadetqalpqr, adetqalpqracquity, acquityxevo, xevotargetlynx, targetlynxuplc, uplcplus, plusmasslynx, masslynxquartile
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
2020|SCIEX|Applications
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolviral, viralpeptide, peptideproteins, proteinsllod, llodcoronavirus, coronavirusquantification, quantificationtargeted, targetedpeptides, peptideshealthy, healthypooled
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgrgwifgttldsk, gwifgttldskadetqalpqr, adetqalpqrkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptidetime, timeratio, ratioarea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptidetargeted, targetedclinicians, cliniciansnstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkarea, areapeak