Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis
Applications | 2020 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordsmrm, cov, xevo, spike, peptide, acquity, gupta, leong, masslynx, geest, average, amount, response, levels, coronavirus, consortium, uplc, plus, acknowledged, quanrecovery, dynamic, kindly, selection, swab, across, reaction, help, class, illustrating, skyline, maximal, hps, optimized, glycoprotein, maxpeak, colored, monitoring, omics, quadrupole, multiple, van, targetlynx, recombinant, efforts, consumable, careful, level, maximizing, medicine, premier
Similar PDF
Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARS-CoV-2 Proteins
2020|Waters|Applications
Application Note Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARSCoV-2 Proteins Stuart Oehrle, Laurence Van Oudenhove, Jan Claereboudt, Hans Vissers, Bart Van Puyvelde, Simon Daled, Katleen Van Uytfanghe, Dieter Deforce, Maarten Dhaenens For…
Key words
unispray, unisprayncap, ncappeptide, peptidepeptides, peptideselectrospray, electrosprayionization, ionizationutm, utmadetqalpqr, adetqalpqracquity, acquityxevo, xevoplus, plusuplc, uplctargetlynx, targetlynxquartile, quartilemasslynx
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
2020|SCIEX|Applications
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolviral, viralpeptide, peptideproteins, proteinsllod, llodcoronavirus, coronavirusquantification, quantificationtargeted, targetedpeptides, peptideshealthy, healthyrecombinant
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggdgiiwvategalntpk, dgiiwvategalntpksrm, srmpeptides, peptidesarea