Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARS-CoV-2 Proteins

Applications | 2020 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Waters

Summary

Importance of the Topic


The quantification of SARS-CoV-2 structural proteins by targeted LC-MS offers a direct measure of viral load in clinical samples, complementing nucleic acid tests and providing orthogonal data on infection status. Reliable detection of Spike and Nucleoprotein peptides in nasopharyngeal swabs can support both research and diagnostic workflows, especially when PCR sensitivity or specificity is challenged.

Study Objectives and Overview


This work compares two ionization interfaces—UniSpray and Electrospray (ESI)—on a Xevo TQ-XS tandem quadrupole mass spectrometer for MRM-based detection of tryptic peptides from SARS-CoV-2 Spike and Nucleoprotein in a Universal Transport Medium (UTM) matrix. The goal is to assess signal-to-noise improvements, dynamic range extension, and selectivity benefits of each source.

Methodology


Recombinant SPIKE and NCAP proteins were digested with trypsin-LysC and freeze-dried as standards. Peptides were reconstituted and spiked into UTM to generate a dilution series. Chromatographic separation employed an ACQUITY UPLC I-Class PLUS system with a peptide-optimized C18 column (2.1×50 mm, 1.7 µm) at 40 °C, 0.6 mL/min flow, and an 8-minute gradient of 5–85% acetonitrile (0.1% FA). MRM acquisition on Xevo TQ-XS used two transitions per peptide with optimized collision energies and cone voltages. Data processing utilized MassLynx and TargetLynx.

Used Instrumentation


  • ACQUITY UPLC I-Class PLUS System
  • ACQUITY PREMIER Peptide BEH C18 Column (2.1×50 mm, 1.7 µm, 300 Å)
  • Xevo TQ-XS Tandem Quadrupole MS
  • UniSpray and Electrospray ionization sources (positive mode)
  • MassLynx and TargetLynx software

Main Results and Discussion


UniSpray demonstrated approximately a 2.5-fold increase in signal-to-noise for the Nucleoprotein peptide ADETQALPQR compared to ESI, enabling reliable quantitation at one additional concentration level without loss of linearity. Across the panel of SPIKE and NCAP peptides, UniSpray yielded on average a four-fold higher peak area. However, a subset of peptides exhibited better response with ESI, underscoring the value of combining both ionization techniques. This complementarity allows selection of the optimal source per peptide to maximize sensitivity and confidence in complex matrices.

Benefits and Practical Applications


  • Enhanced sensitivity for low-abundance viral peptides in clinical matrices
  • Extended dynamic range enabling quantitation over broader concentration spans
  • Flexibility to choose the best ionization method for individual peptides
  • Potential to integrate into diagnostic workflows as a confirmatory or complementary assay

Future Trends and Opportunities


Emerging trends include combining both UniSpray and ESI in multiplexed MRM panels for comprehensive viral proteome coverage, adapting workflows to new SARS-CoV-2 variants, automating sample preparation for high throughput, and extending the approach to other pathogens or biomarker targets. Coupling with high-resolution mass spectrometry and data-independent acquisition could further deepen analytical insights.

Conclusion


UniSpray and Electrospray are complementary ionization techniques that together enhance the sensitivity, dynamic range, and selectivity of targeted LC-MS assays for SARS-CoV-2 peptides. Their combined use on the Xevo TQ-XS platform supports robust quantitative measurement of viral proteins in nasopharyngeal swab samples preserved in UTM.

References


  • 1. WHO Laboratory Testing for 2019 Novel Coronavirus (2019-nCoV) in Suspected Human Cases. Interim Guidance. Jan 17, 2020.
  • 2. Subbaraman N. Coronavirus Tests: Researchers Chase New Diagnostics to Fight the Pandemic. Nature. 2020 Mar 23.
  • 3. Dhaenens M. A Universally Adoptable Corona Multiple Reaction Monitoring Assay. Cov-MS Consortium video presentation.
  • 4. Bongaerts J et al. A Comparative Study of UniSpray and Electrospray Sources for the Ionization of Neuropeptides in LC-MS/MS. J Chromatogr A. 2020;1628:461462.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis
Application Note Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis Laurence Van Oudenhove, Jan Claereboudt, Rowan Moore, Hans Vissers, Bart Van Puyvelde, Simon Daled, Dieter Deforce, Katleen Van Uytfanghe, Steve Silvester, Sally Hannam, Donald…
Key words
mrm, mrmcov, covxevo, xevospike, spikepeptide, peptideacquity, acquitymasslynx, masslynxgupta, guptaleong, leonggeest, geestaverage, averageamount, amountresponse, responselevels, levelscoronavirus
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolpeptide, peptideviral, viralproteins, proteinsllod, llodcoronavirus, coronavirusquantification, quantificationtargeted, targetedpeptides, peptideshealthy, healthypooled
Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO)
Application Note Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO) Dominic Foley, Robert Wardle, Samantha Ferries, Rebecca Pattison, Jennifer Warren, Lisa J. Calton Waters Corporation For research use only. Not for use in diagnostic procedures. Abstract Detection and quantification of…
Key words
acquity, acquityuplc, uplcbiomarkers, biomarkersenrichment, enrichmentclass, classanti, antincap, ncapantibodies, antibodiesxevo, xevoprognostic, prognosticsiscapa, siscaparuo, ruodowntimes, downtimesremoval, removalharmonize
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgrgwifgttldsk, gwifgttldskadetqalpqr, adetqalpqrkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptidetime, timeratio, ratioarea, areamin, minpeptides
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike