Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARS-CoV-2 Proteins
Applications | 2020 | WatersInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Key wordsunispray, ncap, peptide, electrospray, peptides, ionization, utm, adetqalpqr, acquity, xevo, plus, targetlynx, uplc, quartile, masslynx, complementary, class, improved, using, spike, contrasting, cov, consortium, expressing, responding, dynamic, acknowledged, against, quanrecovery, kindly, proteolytic, help, selectivity, mrm, protein, detected, range, further, quantitation, amount, hps, interfaced, maxpeak, quadrupole, levels, digests, efforts, distributions, recombinant, illustrated
Similar PDF
Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis
2020|Waters|Applications
Application Note Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis Laurence Van Oudenhove, Jan Claereboudt, Rowan Moore, Hans Vissers, Bart Van Puyvelde, Simon Daled, Dieter Deforce, Katleen Van Uytfanghe, Steve Silvester, Sally Hannam, Donald…
Key words
mrm, mrmcov, covxevo, xevospike, spikepeptide, peptideacquity, acquitygupta, guptaleong, leongmasslynx, masslynxgeest, geestaverage, averageamount, amountresponse, responselevels, levelscoronavirus
Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
2020|SCIEX|Applications
Targeted assay for quantification of proteins from the SARSCoV-2 coronavirus Using the SCIEX Triple Quad™ 5500+ System – QTRAP® Ready Catherine S. Lane 1, Bart Van Puyvelde2, Katleen Van Uytfanghe2, Maarten Dhaenens2 1 SCIEX, UK, 2Ghent University, Belgium SARS-CoV-2 is…
Key words
nasopharyngeal, nasopharyngealutm, utmassay, assayswabs, swabsfmol, fmolviral, viralpeptide, peptideproteins, proteinsllod, llodcoronavirus, coronavirusquantification, quantificationtargeted, targetedpeptides, peptideshealthy, healthyrecombinant
Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO)
2021|Waters|Applications
Application Note Advancing Research with the SARS-CoV-2 LC-MS Kit (RUO) Dominic Foley, Robert Wardle, Samantha Ferries, Rebecca Pattison, Jennifer Warren, Lisa J. Calton Waters Corporation For research use only. Not for use in diagnostic procedures. Abstract Detection and quantification of…
Key words
acquity, acquitybiomarkers, biomarkersuplc, uplcenrichment, enrichmentanti, anticlass, classantibodies, antibodiesncap, ncapprognostic, prognosticxevo, xevoruo, ruosiscapa, siscapadowntimes, downtimesremoval, removalharmonize
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides