Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
Applications | 2020 | SCIEXInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesProteomics , Clinical Research
ManufacturerSCIEX
Key wordsnasopharyngeal, utm, assay, swabs, fmol, viral, peptide, proteins, llod, quantification, coronavirus, targeted, healthy, peptides, dilution, pooled, recombinant, lloq, researchers, series, mrm, infect, test, nucleocapsid, spiking, developed, detection, particle, from, viruses, were, capsid, two, typical, would, belongs, translate, copies, lung, protein, skyline, planned, mins, prepared, patient, receptor, humans, protective, digests, bioanalytical
Similar PDF
Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis
2020|Waters|Applications
Application Note Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis Laurence Van Oudenhove, Jan Claereboudt, Rowan Moore, Hans Vissers, Bart Van Puyvelde, Simon Daled, Dieter Deforce, Katleen Van Uytfanghe, Steve Silvester, Sally Hannam, Donald…
Key words
mrm, mrmcov, covxevo, xevospike, spikepeptide, peptidegupta, guptaleong, leongacquity, acquitygeest, geestaverage, averagemasslynx, masslynxamount, amountresponse, responselevels, levelscoronavirus
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkarea, areacovid
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARS-CoV-2 Proteins
2020|Waters|Applications
Application Note Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARSCoV-2 Proteins Stuart Oehrle, Laurence Van Oudenhove, Jan Claereboudt, Hans Vissers, Bart Van Puyvelde, Simon Daled, Katleen Van Uytfanghe, Dieter Deforce, Maarten Dhaenens For…
Key words
unispray, unisprayncap, ncappeptide, peptidepeptides, peptideselectrospray, electrosprayionization, ionizationutm, utmadetqalpqr, adetqalpqracquity, acquityxevo, xevoplus, plustargetlynx, targetlynxuplc, uplcmasslynx, masslynxquartile