LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Impurity profiling of the synthetic peptide LL-37 using high-performance liquid chromatography with combined UV and single quadrupole mass spectrometric detection

Applications | 2018 | Thermo Fisher ScientificInstrumentation
HPLC, LC/MS, LC/SQ
Industries
Pharma & Biopharma
Manufacturer
Thermo Fisher Scientific

Summary

Importance of the Topic


The synthetic antimicrobial peptide LL-37 has broad medical applications but requires stringent quality control to ensure safety and efficacy. Impurity profiling is essential to detect low-level process- and product-related by-products that can affect biological activity and regulatory approval. Combining rapid chromatographic separation with complementary detection techniques enhances confidence in impurity identification.

Objectives and Study Overview


This study demonstrates a fast UHPLC-based impurity profiling method for LL-37 using dual UV and single quadrupole mass spectrometric detection. The main goals are to quantify impurity levels via UV absorbance at 214 nm and to confirm peptide identity and detect co-eluting species by full-scan MS up to m/z 2000. Two known LL-37 fragments (RKS and SKE) are spiked into the API to simulate product-related impurities.

Methodology


An Acclaim RSLC 120 C18 column (50 × 2.1 mm, 2.2 µm) at 50 °C is used with a binary gradient of water + 0.1% formic acid (A) and acetonitrile + 0.1% formic acid (B). The gradient ramps from 20% to 50% B over 2 min, holds for 0.1 min, then returns to initial conditions for total run time of 5.5 min. Flow rate is 0.5 mL/min; injection volume is 1 µL; UV is monitored at 214 nm (10 Hz). Full-scan MS is performed in positive mode over m/z 500–2000 with 0.2 s dwell time.

Used Instrumentation


  • Thermo Scientific Vanquish Flex Binary UHPLC
  • Vanquish Binary Pump F
  • Vanquish Split Sampler FT
  • Vanquish Column Compartment H
  • Vanquish Variable Wavelength Detector F (2.5 µL flow cell, 7 mm path)
  • Thermo Scientific ISQ EM single quadrupole mass spectrometer

Main Results and Discussion


UV detection of pure LL-37 yields a single major peak at 1.7 min with no visible impurities, but MS confirms absence of co-eluting species by showing clean full-scan spectra. Spiked fragments are baseline resolved within 2 min (RT 0.9 min for SKE, 1.2 min for RKS). The ISQ EM’s extended range detects charge states from +2 to +8; deconvoluted average masses deviate ≤0.5 Da from theoretical values. Comparison of relative peak areas from UV, total ion chromatogram (TIC), and extracted ion chromatogram (XIC) traces reveals variations due to differing UV responses and ionization efficiencies, highlighting challenges in accurate quantitation without individual calibration or isotopically labeled standards.

Benefits and Practical Applications


  • Combines UV quantitation with MS-based confirmation for enhanced impurity profiling.
  • Rapid gradient method completes analysis in under 6 min, increasing laboratory throughput.
  • Extended MS range enables detection of low-charged peptide species and full charge state characterization.
  • Applicable to QA/QC of peptide APIs, screening for known and unknown impurities.

Future Trends and Applications


Advancements in high-resolution MS and MS/MS fragmentation will improve structural elucidation of unknown peptide impurities. Integration of automated data analysis and AI-driven interpretation can streamline impurity identification. Coupling with multidimensional chromatography may further enhance separation of complex peptide mixtures. These developments will expand the method’s utility to larger peptides and protein therapeutics.

Conclusion


The described UHPLC-UV/MS approach offers a robust, high-throughput solution for impurity profiling of synthetic peptides such as LL-37. The synergy of rapid chromatographic separation, UV quantitation, and extended-range single quadrupole MS delivers reliable detection, identification, and quantitation of low-level impurities within minutes.

References


  • 1. Wu LC, Chen F, Lee SL, Raw A, Yu LX. Building parity between brand and generic peptide products: Regulatory and scientific considerations for quality of synthetic peptides. International Journal of Pharmaceutics. 2017;518:320–334.
  • 2. Chen Y, Yang S, Ho EA. Development of an analytical method for the rapid quantitation of peptides used in microbicide formulations. Chromatographia. 2014;77(23-24):1713–1720.
  • 3. ICH Guidelines Q3A-Q3D: Impurities in New Drug Substances and Products.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Quality Control of Synthetic Biomolecules Using Rapid Methods with Serial Coupling of UV and MS Detectors
Quality Control of Synthetic Biomolecules Using Rapid Methods with Serial Coupling of UV and MS Detectors Sylvia Grosse, Katherine Lovejoy, Martin Samonig, Mauro De Pra, Frank Steiner, Martin Ruehl, Thermo Fisher Scientific, Dornierstrasse 4, 82110 Germering, Germany ABSTRACT INSTRUMENTATION AND…
Key words
mass, massbiomolecules, biomoleculesdna, dnapeptide, peptidepreheater, preheatersequence, sequenceobserved, observedaverage, averageisq, isqatgatattatgattaggagccgcgcagggag, atgatattatgattaggagccgcgcagggagcaggaaacagctatgacccgcgctcacctcgcctctg, caggaaacagctatgacccgcgctcacctcgcctctgllgdffrkskekigkefkrivqrikdflrnlvprtes, llgdffrkskekigkefkrivqrikdflrnlvprtesrkskekigkefkrivqrikdflrnlvprtes, rkskekigkefkrivqrikdflrnlvprtesskekigkefkrivqrikdflr, skekigkefkrivqrikdflrtgaaggaitgcactgaaaggcaggctaat
Thermo Scientific ISQ EC and ISQ EM single quadrupole mass spectrometers
Thermo Scientific ISQ EC and ISQ EM single quadrupole mass spectrometers
2018|Thermo Fisher Scientific|Brochures and specifications
Join the mass movement towards mass spectrometry Thermo Scientific ISQ EC and ISQ EM single quadrupole mass spectrometers Embrace the power of mass spectrometry Achieving a comprehensive understanding of the samples you analyze is always a challenge. At Thermo Fisher…
Key words
isq, isqmass, masshesi, hesiapci, apcispectrometers, spectrometersthermo, thermoscientific, scientificspectrometer, spectrometersim, simtenofovir, tenofoviryour, yourchromeleon, chromeleonimpurity, impurityroutine, routinesensitivity
Oligonucleotide characterization for quality control and increased productivity by single quadrupole mass spectrometer with extended mass range
APPLICATION NOTE 72820 Oligonucleotide characterization for quality control and increased productivity by single quadrupole mass spectrometer with extended mass range Authors Application benefits Katherine Lovejoy, Sylvia Grosse, Mauro de Pra, Martin Samonig, Frank Steiner; Thermo Fisher Scientific, Germering, Germany •…
Key words
mass, massisq, isqimpurity, impurityadducts, adductsspectrometer, spectrometerthermo, thermooligonucleotide, oligonucleotideisobutyryl, isobutyryloligomers, oligomersfound, foundvanquish, vanquishmin, minscientific, scientificpairing, pairingtime
Quality control of oligonucleotides with a single quadrupole mass spectrometer
TECHNICAL NOTE 73670 Quality control of oligonucleotides with a single quadrupole mass spectrometer Author: Stephan Meding Thermo Fisher Scientific, Germering, Germany Keywords: Single quadrupole mass spectrometer, ISQ EM, Vanquish Flex Binary, Chromeleon CDS, intact mass deconvolution Goal Show the benefit…
Key words
mass, massoligonucleotide, oligonucleotideanalyte, analyteisq, isqintensity, intensitycharge, chargecounts, countsdeprotonated, deprotonatedvanquish, vanquishsource, sourcepeak, peakconfirmation, confirmationdeconvolution, deconvolutionadduct, adductsettings
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike