Analysis of a Synthetic Peptide and Its Impurities
Applications | 2020 | Agilent TechnologiesInstrumentation
The reliable separation and characterization of synthetic peptides and their impurities is critical for quality control in biopharmaceutical development. Peptide therapeutics, such as bivalirudin, require precise analytical methods to detect sequence variants, degradation products, and modifications that can affect efficacy and safety.
This application note evaluates an LC method using an Agilent AdvanceBio Peptide Plus column with formic acid (FA) as a mass spectrometry (MS)–compatible modifier. The goals were to achieve high-resolution peptide separations, enable seamless transfer between LC/UV and LC/MS workflows, and identify major impurities in an aged bivalirudin sample.
The chromatographic method employed a 2.1×150 mm AdvanceBio Peptide Plus column at 60 °C with a gradient from 17 % to 95 % acetonitrile in 0.1 % FA. Flow rate was 0.4 mL/min. UV detection used a 5 µL injection, while MS detection used a 1 µL injection.
The LC/UV chromatogram of aged bivalirudin revealed five major peaks. High-resolution MS and MS/MS identified:
The AdvanceBio Peptide Plus stationary phase, bearing a positively charged hybrid surface, provided sharp peaks and high resolution with FA, overcoming the tailing issues found on traditional C18 columns.
This method delivers:
Advancements in peptide chromatography may include further optimization of surface chemistries to improve peak capacity with volatile modifiers. Integration with automated sample handling and advanced MS/MS data analysis will support high-throughput impurity screening. Emerging software tools for de novo sequencing and impurity quantitation are expected to enhance method sensitivity and specificity.
The combination of an Agilent AdvanceBio Peptide Plus column with formic acid mobile phases achieves high-resolution separation and confident MS/MS identification of synthetic peptide impurities. The approach unifies LC/UV and LC/MS workflows for efficient quality control of peptide therapeutics.
HPLC, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Significance of the topic
The reliable separation and characterization of synthetic peptides and their impurities is critical for quality control in biopharmaceutical development. Peptide therapeutics, such as bivalirudin, require precise analytical methods to detect sequence variants, degradation products, and modifications that can affect efficacy and safety.
Objectives and overview of the study
This application note evaluates an LC method using an Agilent AdvanceBio Peptide Plus column with formic acid (FA) as a mass spectrometry (MS)–compatible modifier. The goals were to achieve high-resolution peptide separations, enable seamless transfer between LC/UV and LC/MS workflows, and identify major impurities in an aged bivalirudin sample.
Methodology and instrumentation
The chromatographic method employed a 2.1×150 mm AdvanceBio Peptide Plus column at 60 °C with a gradient from 17 % to 95 % acetonitrile in 0.1 % FA. Flow rate was 0.4 mL/min. UV detection used a 5 µL injection, while MS detection used a 1 µL injection.
Used Instrumentation
- Agilent 1290 Infinity II binary pump, autosampler, and column compartment
- Agilent 1260 Infinity II diode array detector for LC/UV
- Agilent 6545XT AdvanceBio LC/Q-TOF with Dual Agilent Jet Stream source for LC/MS and MS/MS
- Data processed with Agilent OpenLab 2.2 CDS (UV) and MassHunter BioConfirm B.08.00 (MS/MS)
Main results and discussion
The LC/UV chromatogram of aged bivalirudin revealed five major peaks. High-resolution MS and MS/MS identified:
- Peak 1 (m/z 2,049.9467; –129 Da): deletion of a glutamic acid residue confirmed by b15 and y4 fragments
- Peak 2 (m/z 2,178.9894): full-length bivalirudin (monoisotopic mass 2,178.9858 Da)
- Peak 3 (m/z 2,121.9663; –57 Da): glycine deletion
- Peak 4 (m/z 2,160.9764; –18 Da): dehydration (loss of H₂O)
- Peak 5 (m/z 2,179.9742; +1 Da): Asn deamidation to Asp verified by y5 and b15 MS/MS ions
The AdvanceBio Peptide Plus stationary phase, bearing a positively charged hybrid surface, provided sharp peaks and high resolution with FA, overcoming the tailing issues found on traditional C18 columns.
Benefits and practical applications
This method delivers:
- Enhanced peptide separation using MS-friendly mobile phases
- Direct compatibility with both UV and MS detection modes
- Robust identification of sequence variants and degradation products
- Streamlined transfer between QC LC/UV assays and LC/MS impurity profiling
Future trends and possibilities
Advancements in peptide chromatography may include further optimization of surface chemistries to improve peak capacity with volatile modifiers. Integration with automated sample handling and advanced MS/MS data analysis will support high-throughput impurity screening. Emerging software tools for de novo sequencing and impurity quantitation are expected to enhance method sensitivity and specificity.
Conclusion
The combination of an Agilent AdvanceBio Peptide Plus column with formic acid mobile phases achieves high-resolution separation and confident MS/MS identification of synthetic peptide impurities. The approach unifies LC/UV and LC/MS workflows for efficient quality control of peptide therapeutics.
References
- Eggen I. et al. Control Strategies for Synthetic Therapeutic Peptide APIs Part III: Manufacturing Process Considerations. Pharm. Technol. 2014, 38(5).
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Analysis of a Synthetic Peptide and Its Impurities
2020|Agilent Technologies|Applications
Application Note Biopharma Analysis of a Synthetic Peptide and Its Impurities Using mass spectrometry compatible mobile phases with an Agilent AdvanceBio Peptide Plus column Authors Andrew Coffey and Veronica Qin Agilent Technologies, Inc. Abstract Conventionally, chromatographic peptide separation with UV…
Key words
peptide, peptidesynthetic, syntheticgly, glyglu, glumodifier, modifierbivalirudin, bivalirudincharge, chargemass, masscounts, countsdeletion, deletionfprpg, fprpgmobile, mobileprotonate, protonateincompletely, incompletelypositively
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
AdvanceBio Peptide Plus - Peptide Characterization
2020|Agilent Technologies|Presentations
AdvanceBio Peptide Plus Peptide Characterization 1 October 2020 Agilent Technologies . RA.5079050926 What is the AdvanceBio Peptide Plus Column ? AdvanceBio Peptide Plus columns feature a hybrid endcapped C-18 stationary phase on a Poroshell 120 2.7µm superficially porous particle modified…
Key words
advancebio, advancebiopeptide, peptidepeptides, peptidesdeamidated, deamidatedtechnologies, technologiesplus, plusagilent, agilentmapping, mappingsynthetic, syntheticpairs, pairscritical, criticalformic, formicshape, shapehydrophilic, hydrophilicptm
An In‑Depth Analysis of Semaglutide, a Glucagon‑Like Peptide‑1 Receptor Agonist
2024|Agilent Technologies|Applications
Application Note Biopharma/Pharma An In-Depth Analysis of Semaglutide, a Glucagon-Like Peptide-1 Receptor Agonist Comparative IP-RP analytical outcomes using different column chemistries Authors Andrea Angelo P. Tripodi and Andrew Coffey Agilent Technologies, Inc. Abstract Peptide biotherapeutics represent a class of pharmaceuticals…
Key words
semaglutide, semaglutidepeptide, peptideadvancebio, advancebioporous, porousmau, maucolumns, columnspair, pairplus, pluscolumn, columnresponse, responsegly, glytfa, tfafully, fullyplrp, plrpala