Complete Analytical Workflows for GLP-1 Receptor Agonists
Brochures and specifications | 2025 | Agilent TechnologiesInstrumentation
2D-LC, GPC/SEC, HPLC, LC/MS, LC/MS/MS, LC/TOF, LC/HRMS, Software, LC/QQQ, Consumables, LC columns
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Similar PDF
Workflow Solutions for Peptide Therapeutics - Application Compendium
2025|Agilent Technologies|Guides
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabimpurities, impuritiessemaglutide, semaglutidesynthetic, syntheticmsd, msdnotes, notestherapeutics
Characterization of Forced Degradation Impurities of Glucagon-Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry
2024|Agilent Technologies|Applications
Application Note Pharma & Biopharma Characterization of Forced Degradation Impurities of Glucagon‑Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract Peptide biotherapeutics have gained increased attention due to their many therapeutic uses. This application…
Key words
oxidation, oxidationcounts, countsmono, monoamu, amudeconvoluted, deconvolutedmass, masscharge, chargetirzepatide, tirzepatidetri, triliraglutide, liraglutidesemaglutide, semaglutidenative, nativeacquisition, acquisitionforced, forcedoxidized
Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS)
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number TP 625 Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS) David L. Wong1 , Suresh Babu C.V.2 1Agilent Technologies, Inc., Santa Clara, CA, USA 2Agilent Technologies,…
Key words
oxidation, oxidationcounts, countsmono, monotirzepatide, tirzepatidenative, nativetri, trioxidized, oxidizedacquisition, acquisitioncharge, chargemass, massliraglutide, liraglutideorders, ordersmagnitude, magnitudedeconvoluted, deconvolutedunmodified
Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
2025|Agilent Technologies|Applications
Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgimpurities, impuritiespeptide, peptideaegtftsdvssylegqaakefiawlvrgrg, aegtftsdvssylegqaakefiawlvrgrgsequence, sequenceimpurity, impurityadvancebio, advancebiomass, massacquisition, acquisitionmodifications, modificationstruncated, truncatedpeptides, peptidesmhc, mhcseparation
