Complete Analytical Workflows for GLP-1 Receptor Agonists

Brochures and specifications | 2025 | Agilent TechnologiesInstrumentation
2D-LC, GPC/SEC, HPLC, LC/MS, LC/MS/MS, LC/TOF, LC/HRMS, Software, LC/QQQ, Consumables, LC columns
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of Topic


Peptide therapeutics, situated between small molecules and biologics, combine high target specificity with favorable pharmacokinetics, low immunogenicity, and scalable manufacture. The rapid expansion of glucagon-like peptide-1 receptor agonists (GLP-1 RAs) for metabolic and cardiovascular indications underscores the need for robust analytical methods to ensure identity, purity, and stability of these complex molecules.

Objectives and Overview


This compendium presents integrated workflows for the characterization, quantification, and impurity profiling of GLP-1 RAs—including semaglutide, liraglutide, tirzepatide, and related peptides—using liquid chromatography (LC) and mass spectrometry (MS). Key goals are peptide mass confirmation, separation and identification of impurities, sequence confirmation, preparative purification guidance, and bioanalysis in biological matrices.

Methodology and Instrumentation


Orthogonal LC modes—reversed-phase, ion-pair, size-exclusion, and two-dimensional LC—were coupled to various MS platforms (single quad, triple quadrupole, Q-TOF) for intact mass analysis, spectral deconvolution, and tandem MS sequencing. High-acid ion-pair reagents (e.g., TFA, DFA) and superficially porous C18 or polymeric columns optimized impurity resolution. Large-molecule ESI sources produced multiply charged envelopes that were deconvoluted to zero-charge mass. For bioanalysis, stable isotope or analogue peptide calibrants enabled MRM quantitation in plasma.

Instrumentation Used


  • Agilent 1290 Infinity II LC systems (flexible pump, multisampler, thermostats, DAD)
  • Agilent InfinityLab LC/MSD XT and 6495D triple quadrupole MS
  • Agilent 6545XT AdvanceBio LC/Q-TOF
  • OpenLab CDS with Spectral Deconvolution, MassHunter BioConfirm

Main Results and Discussion


• Intact mass confirmation of peptides and oxidized variants via LC/MSD XT with spectral deconvolution demonstrated accurate molecular weights of GLP-1 RAs (±<5 ppm).
• Comparison of column chemistries revealed that Agilent AdvanceBio Peptide Plus columns retained performance under both TFA and FA mobile phases, critical for LC/MS compatibility. Wider-pore polymeric columns improved separation of high-molecular-weight impurities.
• MRM methods on a 6495D LC/TQ achieved sub-ng/mL LOQs for tirzepatide and oxidized analogues, with CVs <6% and accuracies within ±20%.
• Heart-cutting 2D-LC on bio-inert systems separated coeluting degradation products of semaglutide before TOF detection; spectral deconvolution easily assigned identities to low-abundance peaks.
• Forced-degradation studies with H2O2 and high-pH stress revealed mono-, di-, and tri-oxidation species for GLP-1 RAs; deamidation kinetics were profiled at pH 8.9.

Benefits and Practical Applications


These workflows support QC/QA labs and R&D teams by providing:
  • High-throughput intact mass and impurity profiling without high-resolution instruments
  • Optimized preparative LC guidance for peptide purification
  • Sensitive bioanalytical quantitation in preclinical matrices
  • Efficient forced-degradation monitoring to inform formulation and shelf-life

Future Trends and Opportunities


Next-generation peptide analytics will harness ion-mobility MS, retro-inverso peptides, bicyclic and cell-penetrating modalities, and AI-driven method optimization. Advanced 2D and multidimensional LC approaches, coupled with high-throughput deconvolution software, will further streamline characterization of increasingly complex bioconjugates and multi-target therapeutics.

Conclusion


A comprehensive LC/MS toolkit combining orthogonal separations, optimized stationary phases, and targeted MS detection has been established for GLP-1 receptor agonists. Integrated software workflows enable rapid peptide mass confirmation, impurity identification, and quantitation, facilitating robust development and quality control of peptide-based drugs.

References


  • 1. Pereira AJ, de Campos LJ, Xing H, et al. Peptide-based therapeutics: challenges and solutions. Medicinal Chemistry Research 2024;33:1275–1280.
  • 2. Xiao W, Jiang W, Chen Z, et al. Advance in peptide-based drug development: delivery platforms, therapeutics and vaccines. Signal Transduct Target Ther 2025;10.
  • 3. US FDA. ANDAs for Certain Highly Purified Synthetic Peptide Drug Products That Refer to Listed Drugs for rDNA Origin. 2021.
  • 4. ICH Q5E. Comparability of Biotechnological/Biological Products. 2005.
  • 5. D’Hondt M, Bracke N, Taevernier L, et al. Related impurities in peptide medicines. J Pharm Biomed Anal 2014;101:2–30.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Workflow Solutions for Peptide Therapeutics - Application Compendium
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabsemaglutide, semaglutideimpurities, impuritiessynthetic, syntheticmsd, msdtherapeutics, therapeuticsnotes
Characterization of Forced Degradation Impurities of Glucagon-Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry
Application Note Pharma & Biopharma Characterization of Forced Degradation Impurities of Glucagon‑Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract Peptide biotherapeutics have gained increased attention due to their many therapeutic uses. This application…
Key words
oxidation, oxidationcounts, countsmono, monoamu, amudeconvoluted, deconvolutedmass, masscharge, chargetirzepatide, tirzepatidetri, triliraglutide, liraglutidesemaglutide, semaglutidenative, nativeacquisition, acquisitionforced, forcedoxidized
Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgimpurities, impuritiespeptide, peptideaegtftsdvssylegqaakefiawlvrgrg, aegtftsdvssylegqaakefiawlvrgrgsequence, sequenceimpurity, impurityadvancebio, advancebiomass, massacquisition, acquisitionmodifications, modificationstruncated, truncatedpeptides, peptidesmhc, mhcseparation
Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS)
Poster Reprint ASMS 2025 Poster number TP 625 Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS) David L. Wong1 , Suresh Babu C.V.2 1Agilent Technologies, Inc., Santa Clara, CA, USA 2Agilent Technologies,…
Key words
oxidation, oxidationcounts, countsmono, monotirzepatide, tirzepatidenative, nativetri, trioxidized, oxidizedacquisition, acquisitioncharge, chargemass, massliraglutide, liraglutideorders, ordersmagnitude, magnitudedeconvoluted, deconvolutedunmodified
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike