Characterization of Forced Degradation Impurities of Glucagon-Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry

Applications | 2024 | Agilent TechnologiesInstrumentation
LC/MS, LC/MS/MS, LC/HRMS, LC/TOF
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the topic


Peptide biotherapeutics such as glucagon-like peptide-1 (GLP-1) agonists play a critical role in diabetes and obesity management. Understanding their stability under stress conditions is essential to ensure safety, efficacy, and consistent quality during development and manufacturing.

Objectives and study overview


This study aimed to characterize forced degradation impurities of three GLP-1 agonists (liraglutide, semaglutide, tirzepatide) under oxidative and alkaline stress using liquid chromatography/quadrupole time-of-flight mass spectrometry (LC/Q-TOF MS). The goal was to identify structural changes and assess method suitability for quality control applications.

Methodology and instrumentation


The analysis employed an Agilent 1290 Infinity II Bio LC system with an AdvanceBio Peptide Mapping column and an Agilent 6545XT AdvanceBio LC/Q-TOF mass spectrometer. MassHunter data acquisition and BioConfirm software enabled spectral deconvolution. Forced oxidation was induced by incubating peptides at 0.05–2% H2O2 overnight; deamidation stress used pH 8.9 buffer at 37 °C for up to 24 days.

Main results and discussion


Oxidative stress generated mono-, di-, and tri-oxidized species with mass shifts of +16, +32, and +48 Da, respectively. Chromatographic separation resolved isomeric oxidation products, highlighting tryptophan as the primary oxidation site. Extracted ion chromatograms revealed mono-oxidation as the predominant pathway. Alkaline stress showed negligible deamidation over 24 days, reflecting the lower reactivity of glutamine residues.

Benefits and practical applications


  • High-resolution identification of peptide impurities supports robust drug characterization.
  • Fast method suitable for routine quality control and stability testing.
  • Enhanced ability to resolve and quantify isomeric degradation products.

Future trends and applications


Integration of higher-resolution MS instruments and advanced data-processing algorithms may further improve impurity profiling. Expanding stress conditions to include photodegradation and enzymatic cleavage can deepen understanding of biotherapeutic stability.

Conclusion


The LC/Q-TOF MS workflow proved effective for detailed mapping of GLP-1 agonist degradation products under stress. It offers a reliable platform for ensuring the quality and safety of peptide-based therapies.

References


  1. Müller T. D. et al. Glucagon-Like Peptide 1 (GLP-1). Mol. Metab. 2019, 30, 72–130.
  2. Kiese S. et al. Mechanical Stress Testing of an IgG1 Antibody. J. Pharm. Sci. 2008, 97(10), 4347–4366.
  3. ICH Expert Working Group. Quality of Biotechnological Products: Stability Testing Q5C. ICH, 1995.
  4. Bellmaine S. et al. Reactivity and Degradation Products of Tryptophan. Free Radic. Biol. Med. 2020, 160, 696–718.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS)
Poster Reprint ASMS 2025 Poster number TP 625 Characterization and Quantification of Glucagon Like Peptide-1 Agonists and their Impurities Using Liquid Chromatography/Mass Spectrometry (LC/MS) David L. Wong1 , Suresh Babu C.V.2 1Agilent Technologies, Inc., Santa Clara, CA, USA 2Agilent Technologies,…
Key words
oxidation, oxidationcounts, countsmono, monotirzepatide, tirzepatidenative, nativeoxidized, oxidizedtri, triacquisition, acquisitioncharge, chargemass, massliraglutide, liraglutideorders, ordersmagnitude, magnitudedeconvoluted, deconvolutedunmodified
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Monitoring Stability and Impurity Products of GLP-1 Agonists Using a Novel Single Quadrupole LC/MS
Poster Reprint ASMS 2025 Poster number TP 644 Monitoring Stability and Impurity Products of GLP-1 Agonists Using a Novel Single Quadrupole LC/MS Mahsan Miladi , Behrooz Zekavat Agilent Technologies, Santa Clara, CA, USA Introduction Experimental Glucagon-like peptide-1 (GLP-1) receptor agonists,…
Key words
semaglutide, semaglutideoxidation, oxidationtirzepatide, tirzepatidetirazeptide, tirazeptideimpurity, impurityplus, pluspro, proimpurities, impuritiesmono, monoagilent, agilentrelated, relatedincretin, incretinrld, rldgip, gipintact
Impurity Profiling of GLP-1 Receptor Agonists by HILIC-MS
Impurity Profiling of GLP-1 Receptor Agonists by HILIC-MS
2025|Agilent Technologies|Applications
Application Note Pharma Impurity Profiling of GLP-1 Receptor Agonists by HILIC-MS Using an Agilent 1290 Infinity III Bio LC System and Agilent InfinityLab LC/MSD iQ Authors Abstract Piotr Alvarez, Cindy Lecluyse, Griet Debyser, Pat Sandra, and Koen Sandra RIC group…
Key words
exenatide, exenatidecharge, chargetirzepatide, tirzepatideabundance, abundancesemaglutide, semaglutiderelative, relativeresponse, responsehilic, hilicaib, aibmass, massimpurities, impuritiesmau, mauretention, retentionpeptide, peptidemin
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike