Impurity Profiling of GLP-1 Receptor Agonists by HILIC-MS

Applications | 2025 | Agilent TechnologiesInstrumentation
LC/MS, LC/SQ
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Importance of the Topic


GLP-1 receptor agonists represent a key class of biotherapeutic peptides for managing type 2 diabetes and obesity. Ensuring the safety and efficacy of these agents requires comprehensive impurity profiling, as structural variants can arise during synthesis or storage and may impact drug performance and regulatory compliance.

Objectives and Study Overview


This application note demonstrates an orthogonal hydrophilic interaction liquid chromatography–mass spectrometry (HILIC-MS) method for profiling impurities in Exenatide, Semaglutide, and Tirzepatide. The goals are to achieve robust separation of product-related variants and to confirm their identities using a compact single quadrupole MS system.

Methodology and Instrumentation


Samples of Exenatide, Semaglutide, and Tirzepatide were prepared in DMSO or acetonitrile/water, with a forced oxidation step applied to Exenatide. Separation employed a deactivated stainless-steel HILIC-Z column and an Agilent 1290 Infinity III Bio LC System coupled to an Agilent InfinityLab LC/MSD iQ single quadrupole MS. The mobile phase comprised ammonium formate buffer (pH 3) and acetonitrile with a gradient from 90 % to 45 % organic over 20 minutes at 0.4 mL/min. UV detection at 280 nm and positive-mode electrospray MS (m/z 500–1450) were used to monitor eluting peptides and impurities while minimizing nonspecific adsorption.

Main Results and Discussion


The HILIC method achieved clear resolution of the three therapeutic peptides and their low-level impurities. Key findings include:
  • Tirzepatide impurity at 1.1 % identified as a tyrosine insertion (+163 Da) by extracted ion chromatography (EIC) and MS.
  • Semaglutide impurities at 0.2–0.4 % comprising a stereoisomeric variant, an N-terminal histidine cyclization (+12 Da), and a truncated form (–222 Da).
  • Exenatide variants including methionine oxidation (+16 Da), glycine addition (+57 Da), leucine/isoleucine insertion (+113 Da), and N-terminal histidine deletion (–137 Da); forced oxidation produced separable R and S sulfoxide diastereomers.
Use of a single quadrupole MS enabled detection of coeluting or tailing impurities that would be challenging to quantify by UV alone.

Benefits and Practical Applications


The described HILIC-MS platform offers an orthogonal separation to reversed-phase LC, enhancing impurity coverage in peptide therapeutics. The biocompatible hardware prevents metal-induced adsorption, and the stackable single quadrupole MS provides accessible mass confirmation. This approach supports both routine quality control and forced degradation studies.

Future Trends and Applications


Further refinements could include targeted gradient adjustments to resolve stereoisomeric sulfoxides, integration into two-dimensional LC workflows for comprehensive profiling, and coupling with higher-resolution MS or data-driven algorithms for automated impurity identification. Ongoing development of novel HILIC stationary phases may improve selectivity for challenging peptide variants.

Conclusion


The presented HILIC-MS method is a versatile and robust solution for impurity profiling of GLP-1 receptor agonists. Its orthogonal retention mechanism and MS confirmation capability make it a valuable tool for ensuring peptide drug quality and regulatory compliance.

Used Instrumentation


  • Agilent 1290 Infinity III Bio High-Speed Pump and Multisampler with Thermostat
  • Agilent 1290 Infinity III Multicolumn Thermostat with Bio Heat Exchanger
  • Agilent 1290 Infinity III Diode Array Detector (280 nm)
  • Agilent InfinityLab LC/MSD iQ single quadrupole mass detector

References


  1. Yu M, Benjamin MM, Srinivasan S, Morin EE, Shishatskaya EI, Schwendeman SP, Schwendeman A. Battle of GLP-1 Delivery Technologies. Adv Drug Deliv Rev. 2018;130:113–130.
  2. D’Hondt M, Bracke N, Taevernier L, Gevaert B, Verbeke F, Wynendaele E, De Spiegeleer B. Related Impurities in Peptide Medicines. J Pharm Biomed Anal. 2014;101:2–30.
  3. Alvarez P, Lecluyse C, Vandendriessche I, Sandra P, Sandra K, Schneider S, Huber U. HILIC Analysis of GLP-1 Receptor Agonists Using an Agilent 1290 Infinity III Bio LC with DAD and ELSD. Agilent Technologies application note 5994-8308EN, 2025.
  4. McCalley DV. Understanding and Manipulating the Separation in Hydrophilic Interaction Liquid Chromatography. J Chromatogr A. 2017;1523:49–71.
  5. Guimaraes GJ, Bartlett MG. Managing Nonspecific Adsorption to Liquid Chromatography Hardware: a Review. Anal Chim Acta. 2023;1250:340994.
  6. European Medicines Agency. Draft guideline on the development and manufacture of synthetic peptides; EMA/CHMP/CVMP/QWP/387541/2023.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
HILIC Analysis of GLP-1 Receptor Agonists
HILIC Analysis of GLP-1 Receptor Agonists
2025|Agilent Technologies|Applications
Application Note Pharma HILIC Analysis of GLP-1 Receptor Agonists Using an Agilent 1290 Infinity III Bio LC with DAD and ELSD Authors Piotr Alvarez, Cindy Lecluyse, Ine Vandendriessche, Pat Sandra, and Koen Sandra RIC group President Kennedypark 6, 8500 Kortrijk,…
Key words
exenatide, exenatidesemaglutide, semaglutidebyetta, byettaelsd, elsdozempic, ozempicliraglutide, liraglutidehilic, hilicxultophy, xultophyresponse, responsetirzepatide, tirzepatidedeactivated, deactivatedsst, sststainless, stainlesssteel, steelmau
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance
Characterization of Forced Degradation Impurities of Glucagon-Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry
Application Note Pharma & Biopharma Characterization of Forced Degradation Impurities of Glucagon‑Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract Peptide biotherapeutics have gained increased attention due to their many therapeutic uses. This application…
Key words
oxidation, oxidationcounts, countsmono, monoamu, amudeconvoluted, deconvolutedmass, masscharge, chargetirzepatide, tirzepatidetri, triliraglutide, liraglutidesemaglutide, semaglutidenative, nativeacquisition, acquisitionforced, forcedoxidized
Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgimpurities, impuritiespeptide, peptideaegtftsdvssylegqaakefiawlvrgrg, aegtftsdvssylegqaakefiawlvrgrgsequence, sequenceimpurity, impurityadvancebio, advancebiomass, massacquisition, acquisitionmodifications, modificationstruncated, truncatedpeptides, peptidesmhc, mhcseparation
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike