Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
Applications | 2025 | Agilent TechnologiesInstrumentation
Peptide-based therapeutics such as semaglutide play a pivotal role in modern medicine, offering high target specificity and favorable pharmacokinetics. Accurate separation and identification of semaglutide-related impurities are critical for ensuring drug safety, efficacy, and compliance with stringent regulatory standards. Advanced analytical workflows combining multidimensional chromatography and high-resolution mass spectrometry address challenges arising from closely related peptide variants and MS-incompatible buffers.
This work demonstrates an online two-dimensional liquid chromatography (2D-LC) workflow coupled to time-of-flight mass spectrometry (Q-TOF) for comprehensive characterization of semaglutide and its by-products. The objectives include:
The analytical scheme employs:
Implementation of the 2D-LC/Q-TOF workflow enabled:
The described 2D-LC/Q-TOF strategy offers:
Future directions include:
The advanced 2D-LC/Q-TOF workflow combines orthogonal chromatographic dimensions with high-resolution mass spectrometry and specialized software to deliver comprehensive impurity characterization of semaglutide. This methodology enhances separation power, ensures MS compatibility, and provides reliable identification of peptide variants, supporting rigorous quality control in biopharmaceutical research and production.
LC/MS, LC/MS/MS, LC/HRMS, LC/TOF, 2D-LC
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Význam tématu
Peptide-based therapeutics such as semaglutide play a pivotal role in modern medicine, offering high target specificity and favorable pharmacokinetics. Accurate separation and identification of semaglutide-related impurities are critical for ensuring drug safety, efficacy, and compliance with stringent regulatory standards. Advanced analytical workflows combining multidimensional chromatography and high-resolution mass spectrometry address challenges arising from closely related peptide variants and MS-incompatible buffers.
Cíle a přehled studie / článku
This work demonstrates an online two-dimensional liquid chromatography (2D-LC) workflow coupled to time-of-flight mass spectrometry (Q-TOF) for comprehensive characterization of semaglutide and its by-products. The objectives include:
- Achieve efficient separation of semaglutide impurities coeluting in conventional one-dimensional methods.
- Enable impurity desalting and MS compatibility via a heart-cutting 2D-LC approach.
- Apply accurate mass detection and MS/MS fragmentation for sequence confirmation of synthetic and truncated peptide variants.
Použitá metodika a instrumentace
The analytical scheme employs:
- First dimension: Agilent 1290 Infinity III bio 2D-LC equipped with an AdvanceBio Peptide Plus C18 column and phosphate buffer-based mobile phase for high chromatographic resolution.
- Second dimension: Agilent 1290 Infinity III bio 2D-LC with AdvanceBio RP-mAb C4 column and volatile formic acid–acetonitrile gradients for desalting and MS compatibility.
- Detection: Agilent 6545XT AdvanceBio LC/Q-TOF with Dual Jet Stream ESI source operated in extended dynamic range for accurate mass and high-sensitivity MS/MS data.
- Sampling: Multiple heart-cutting (MHC) loops and high-resolution (HiRes) multi-injection to capture narrow impurity peaks across the chromatogram.
- Software: Agilent MassHunter BioConfirm 12.1 for automated intact mass matching and sequence confirmation of semaglutide and its variants.
Hlavní výsledky a diskuse
Implementation of the 2D-LC/Q-TOF workflow enabled:
- Baseline separation of low-abundance peptide impurities that coelute with the main semaglutide peak in 1D LC.
- Identification of truncated sequences (e.g., missing histidine or α-methylalanine) and isomeric forms via exact mass within ±5 ppm and diagnostic MS/MS fragmentation patterns.
- Efficient desalting step in the second dimension preserving first-dimension resolution, yielding high-quality spectra for both intact peptide and truncation products.
- Throughput gains achieved by HiRes multi-injection, allowing up to ten heart-cut fractions per run without hardware modifications.
Přínosy a praktické využití metody
The described 2D-LC/Q-TOF strategy offers:
- Robust impurity profiling essential for quality control in peptide drug development and manufacturing.
- Enhanced confidence in sequence confirmation and identification of post-synthesis modifications.
- Improved regulatory compliance by comprehensive detection of potential degradation products.
- Adaptability to other peptide or protein therapeutics requiring MS-incompatible buffers in primary separation.
Budoucí trendy a možnosti využití
Future directions include:
- Integration of real-time data analytics and machine learning for automated peak selection in multidimensional workflows.
- Expansion to 3D-LC techniques for even greater resolution of highly complex peptide mixtures.
- Application to biosimilars and advanced bioconjugates where minor structural variants demand high-precision analysis.
- Miniaturization of 2D-LC interfaces and microfluidic platforms to reduce solvent consumption and increase throughput.
Závěr
The advanced 2D-LC/Q-TOF workflow combines orthogonal chromatographic dimensions with high-resolution mass spectrometry and specialized software to deliver comprehensive impurity characterization of semaglutide. This methodology enhances separation power, ensures MS compatibility, and provides reliable identification of peptide variants, supporting rigorous quality control in biopharmaceutical research and production.
Reference
- Singh S. et al. PEPstrMOD: Structure Prediction of Peptides Containing Natural, Non-Natural and Modified Residues. Biol. Direct. 2015, 10:73.
- D’Hondt M. et al. Related Impurities in Peptide Medicines. J. Pharm. Biomed. Anal. 2014, 101:2–30.
- Zhang B. et al. Characterization of Low Level D-Amino Acid Isomeric Impurities of Semaglutide Using LC-HRMS/MS. J. Pharm. Biomed. Anal. 2023, 224:115164.
- Latif W. et al. Compare and Contrast the Glucagon-Like Peptide-1 Receptor Agonists (GLP1RAs). StatPearls. 2024.
- Buckenmaier S.; Petersson P. Analysis of Peptide/Protein-Related Impurities Using Bio 2D-LC/Q-TOF and MassHunter. Agilent Technol. 2024.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance
Advanced Characterization of Semaglutideand Its Impurities Using a Heart-Cutting 2D-LC/MS Workflow for Biopharmaceutical Analysis
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number TP 638 Advanced Characterization of Semaglutide and Its Impurities Using a Heart-Cutting 2D-LC/MS Workflow for Biopharmaceutical Analysis Tanya Jones1, Paramjeet Khandpur2 , Ashish Pargaonkar2, Preeti Bharatiya2 1Agilent Technologies, Inc. Raleigh, NC 2Agilent Technologies, Inc.…
Key words
bioconfirm, bioconfirmhires, hiressemaglutide, semaglutidetemp, tempflowrate, flowrateimpurities, impuritiesmain, mainmultiinject, multiinjectlateeluting, lateelutingsampling, samplingfocused, focuseddimension, dimensioncolumn, columnemulating, emulatingmodifications
LC/MS Based Characterization Workflow of GLP-1 Therapeutic Peptide Liraglutide and Its Impurities
2024|Agilent Technologies|Applications
Application Note Biopharmaceuticals LC/MS Based Characterization Workflow of GLP-1 Therapeutic Peptide Liraglutide and Its Impurities Authors Shadab Ahmad Centre for Cellular and Molecular Platforms (C-CAMP) Bengaluru, India Nirpendra Singh Institute for Stem Cell Science and Regenerative Medicine (InStem) Bengaluru, India.…
Key words
liraglutide, liraglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrglir, lirimpurities, impuritiescounts, countsdes, despeptide, peptidebioconfirm, bioconfirmmass, massimpurity, impuritytherapeutic, therapeuticcharge, chargeintact, intactworkflow, workflowhaegtftsdvssylegqaakefiawlvrgr
Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform
2025|Thermo Fisher Scientific|Applications
Application note | 003920 Pharma Confident and sensitive identification of semaglutide degradation products and impurities using a UHPLC-HRAM MS platform Authors Application benefits Xuepu Li1, Xiaoxi Zhang1, Min Du2, Roberto Gamez , Sylvia Grosse 3 • The Thermo Scientific™ Hypersil…
Key words
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgoxidation, oxidationpeptide, peptidedegradation, degradationstressed, stressedimpurities, impuritiesproducts, productsoxidative, oxidativehaegftsdvssylegqaakefiawlvrgrg, haegftsdvssylegqaakefiawlvrgrguhplc, uhplchram, hramfinder, finderbiopharma, biopharmaaegtftsdvssylegqaakefiawlvrgrg