Monitoring Stability and Impurity Products of GLP-1 Agonists Using a Novel Single Quadrupole LC/MS
Posters | 2025 | Agilent Technologies | ASMSInstrumentation
Glucagon-like peptide-1 receptor agonists such as semaglutide and tirzepatide are essential therapies for type 2 diabetes and obesity management by enhancing insulin secretion and metabolic control. Monitoring their stability and impurity profiles ensures efficacy and safety.
This study evaluates the stability and degradation products of semaglutide and tirzepatide under varying pH and storage conditions using a novel single quadrupole LC/MS platform.
A stock solution of each peptide was prepared and diluted in pH 5, 7, and 9 buffers then stored at 5 °C. Samples were analyzed over seven days without additional cleanup using an Agilent 1290 Infinity II Bio LC coupled to a Pro iQ Plus single quadrupole mass detector. Chromatographic separation employed a ZORBAX RRHD StableBond C18 column with a water/acetonitrile gradient containing 0.1% formic acid. Mass spectra were acquired in positive mode across m/z 500–2500.
Tirzepatide and semaglutide both exhibited oxidation and dioxidation impurities detectable at levels below 2% relative area. Deconvoluted masses aligned within ±0.3 Da of theoretical values. Kinetic profiling revealed tirzepatide is most susceptible to oxidation at pH 5 while semaglutide degrades more at pH 9.
The sensitive, user-friendly LC/MS method is suitable for routine quality control and stability testing in pharmaceutical laboratories.
Advancements may include higher-resolution mass analyzers, real-time degradation monitoring, and integration with automated workflows for peptide therapeutics development and regulatory compliance.
The Agilent Pro iQ Plus single quadrupole LC/MS system demonstrates robust performance for low-level impurity detection in GLP-1 agonists, supporting stability studies and quality assurance.
LC/MS, LC/SQ
IndustriesPharma & Biopharma, Proteomics
ManufacturerAgilent Technologies
Summary
Significance of the topic
Glucagon-like peptide-1 receptor agonists such as semaglutide and tirzepatide are essential therapies for type 2 diabetes and obesity management by enhancing insulin secretion and metabolic control. Monitoring their stability and impurity profiles ensures efficacy and safety.
Objectives and Study Overview
This study evaluates the stability and degradation products of semaglutide and tirzepatide under varying pH and storage conditions using a novel single quadrupole LC/MS platform.
Methodology and Instrumentation
A stock solution of each peptide was prepared and diluted in pH 5, 7, and 9 buffers then stored at 5 °C. Samples were analyzed over seven days without additional cleanup using an Agilent 1290 Infinity II Bio LC coupled to a Pro iQ Plus single quadrupole mass detector. Chromatographic separation employed a ZORBAX RRHD StableBond C18 column with a water/acetonitrile gradient containing 0.1% formic acid. Mass spectra were acquired in positive mode across m/z 500–2500.
Main Results and Discussion
Tirzepatide and semaglutide both exhibited oxidation and dioxidation impurities detectable at levels below 2% relative area. Deconvoluted masses aligned within ±0.3 Da of theoretical values. Kinetic profiling revealed tirzepatide is most susceptible to oxidation at pH 5 while semaglutide degrades more at pH 9.
Practical Benefits and Applications
The sensitive, user-friendly LC/MS method is suitable for routine quality control and stability testing in pharmaceutical laboratories.
Future Trends and Potential Applications
Advancements may include higher-resolution mass analyzers, real-time degradation monitoring, and integration with automated workflows for peptide therapeutics development and regulatory compliance.
Conclusion
The Agilent Pro iQ Plus single quadrupole LC/MS system demonstrates robust performance for low-level impurity detection in GLP-1 agonists, supporting stability studies and quality assurance.
References
- Vilsbøll T, Christensen M, Junker AE, Knop FK, Gluud LL. Effects of Glucagon-Like Peptide-1 Receptor Agonists on Weight Loss: Systematic Review and Meta-Analyses of Randomised Controlled Trials. BMJ. 2012;344:d7771.
- U.S. Food and Drug Administration, Center for Drug Evaluation Research. ANDAs for Certain Highly Purified Synthetic Peptide Drug Products That Refer to Listed Drugs for rDNA Origin; Guidance for Industry. 2021.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Impurity Profiling of Tirzepatide Under Stress Conditions
2025|Agilent Technologies|Applications
Application Note Biopharma/Pharma Impurity Profiling of Tirzepatide Under Stress Conditions Using Agilent Pro iQ Plus Author Mahsan Miladi, PhD Agilent Technologies, Inc. Abstract The increased demand and use of glucagon-like peptide-1 (GLP-1) agonists prompts a need for robust analytical methods…
Key words
tirzepatide, tirzepatideplus, pluspro, proimpurities, impuritiespeptide, peptidespectrum, spectrummass, massopenlab, openlabincretin, incretinthreshold, thresholdimpurity, impuritycds, cdsagilent, agilentoxidation, oxidationdeconvolution
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutidetirzepatide, tirzepatideoxidation, oxidationsemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Characterization of Forced Degradation Impurities of Glucagon-Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry
2024|Agilent Technologies|Applications
Application Note Pharma & Biopharma Characterization of Forced Degradation Impurities of Glucagon‑Like Peptide-1 Agonists by LC/Q-TOF Mass Spectrometry Author Suresh Babu C.V. Agilent Technologies, Inc. Abstract Peptide biotherapeutics have gained increased attention due to their many therapeutic uses. This application…
Key words
oxidation, oxidationcounts, countsmono, monoamu, amudeconvoluted, deconvolutedmass, masscharge, chargetirzepatide, tirzepatidetri, triliraglutide, liraglutidesemaglutide, semaglutidenative, nativeacquisition, acquisitionforced, forcedoxidized
Fast Track to Certainty: Confident Biopharma Decisions with LC-Single Quadrupole Mass Detection
2025|Agilent Technologies|Guides
Table of contents Fast Track to Certainty: Confident Biopharma Decisions with LC-Single Quadrupole Mass Detection How single quadrupole LC/MS simplifies identification, purification, and stability assessment in biopharma Table of Contents Introduction��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������� 3 Consolidating Biopharma QC Workflows: LC/UV Versus Single Quadrupole…
Key words
contents, contentstable, tablemass, masspro, proplus, plusabundance, abundancetrastuzumab, trastuzumabmoera, moeraunknown, unknownrelative, relativeabundances, abundancesagilent, agilentmoerc, moercmoe, moethreshold