Impurity Profiling of Tirzepatide Under Stress Conditions
Applications | 2025 | Agilent TechnologiesInstrumentation
The rise of GLP-1 receptor agonists such as tirzepatide in treating type-2 diabetes and obesity has intensified the need for reliable analytical methods. Peptide drugs are prone to degradation via oxidation, deamidation and backbone cleavage, which can affect their safety and efficacy. Accurate impurity profiling under stress conditions is therefore critical for ensuring product quality and regulatory compliance.
This study evaluates the performance of a single-quadrupole LC/MS system (Agilent InfinityLab Pro iQ Plus) for detecting low-level tirzepatide impurities formed under different pH (5, 7 and 9) and storage durations (up to 7 days at 5 °C). The goal was to demonstrate a streamlined, cost-effective workflow suitable for routine QC/QA environments.
The system reliably detected native tirzepatide (4 813.1 Da) and two oxidation products (+32 Da and +4.4 Da) at retention times 7.57 and 7.71 min, as well as an unknown degradant at ~4 689.6 Da. Charge states +3, +4 and +5 were clearly resolved. Oxidation increased over time, especially at pH 5, with relative impurity levels below 2 % detectable even after one week.
The Pro iQ Plus LC/MS workflow offers high sensitivity for trace impurities, broad dynamic range, integrated deconvolution and minimal method complexity. Its cost-effectiveness and ease of use make it ideal for routine pharmaceutical QC/QA laboratories.
Further developments may include MS/MS for structural elucidation of unknown degradants, enhanced automation of data processing, extension to other peptide therapeutics and method transfer across regulatory environments.
This work demonstrates that a single-quadrupole LC/MS platform can efficiently profile tirzepatide impurities under stress conditions, ensuring robust quality control and safeguarding therapeutic performance.
LC/MS, LC/SQ
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Importance of the topic
The rise of GLP-1 receptor agonists such as tirzepatide in treating type-2 diabetes and obesity has intensified the need for reliable analytical methods. Peptide drugs are prone to degradation via oxidation, deamidation and backbone cleavage, which can affect their safety and efficacy. Accurate impurity profiling under stress conditions is therefore critical for ensuring product quality and regulatory compliance.
Objectives and Study Overview
This study evaluates the performance of a single-quadrupole LC/MS system (Agilent InfinityLab Pro iQ Plus) for detecting low-level tirzepatide impurities formed under different pH (5, 7 and 9) and storage durations (up to 7 days at 5 °C). The goal was to demonstrate a streamlined, cost-effective workflow suitable for routine QC/QA environments.
Methodology and Instrumentation
- Sample Preparation: Tirzepatide stock solution (2 mg/mL) in 15 % acetonitrile/water was diluted to 50 ng/µL in buffers at pH 5, 7 and 9. Samples were stored at 5 °C in the autosampler and analyzed after 1, 3 and 7 days without additional cleanup.
- Chromatography: Agilent 1290 Infinity II Bio LC with ZORBAX RRHD 300 Å StableBond C18 column (2.1×150 mm, 1.8 µm). Gradient elution from 20 % to 80 % acetonitrile (+0.1 % formic acid) over 15 min, flow rate 0.4 mL/min, column at 60 °C, 1 µL injection.
- Mass Spectrometry: Agilent InfinityLab Pro iQ Plus single quadrupole MS in positive ESI mode; m/z range 500–2 500, fragmentor 95 V, source temperatures 300 °C (drying) and 250 °C (sheath gas).
- Data Analysis: Agilent OpenLab CDS 2.8 with integrated spectral deconvolution optimized for multiply charged peptides.
Main Results and Discussion
The system reliably detected native tirzepatide (4 813.1 Da) and two oxidation products (+32 Da and +4.4 Da) at retention times 7.57 and 7.71 min, as well as an unknown degradant at ~4 689.6 Da. Charge states +3, +4 and +5 were clearly resolved. Oxidation increased over time, especially at pH 5, with relative impurity levels below 2 % detectable even after one week.
Benefits and Practical Applications
The Pro iQ Plus LC/MS workflow offers high sensitivity for trace impurities, broad dynamic range, integrated deconvolution and minimal method complexity. Its cost-effectiveness and ease of use make it ideal for routine pharmaceutical QC/QA laboratories.
Future Trends and Possibilities
Further developments may include MS/MS for structural elucidation of unknown degradants, enhanced automation of data processing, extension to other peptide therapeutics and method transfer across regulatory environments.
Conclusion
This work demonstrates that a single-quadrupole LC/MS platform can efficiently profile tirzepatide impurities under stress conditions, ensuring robust quality control and safeguarding therapeutic performance.
Reference
- Badgujar D. et al., J. Pept. Sci. 2025, 31, e3652.
- Vilsbøll T. et al., BMJ 2012, 344, d7771.
- Davidson M. H., Am. J. Cardiol. 2011, 108(3 Suppl), 33B–41B.
- FDA Guidance for Industry, 2021.
- Wang J. et al., ACS Omega 2022, 7, 46809–46824.
- Datola A. et al., J. Mass Spectrom. 2023, 58(5), e4919.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Fast Track to Certainty: Confident Biopharma Decisions with LC-Single Quadrupole Mass Detection
2025|Agilent Technologies|Guides
Table of contents Fast Track to Certainty: Confident Biopharma Decisions with LC-Single Quadrupole Mass Detection How single quadrupole LC/MS simplifies identification, purification, and stability assessment in biopharma Table of Contents Introduction��������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������� 3 Consolidating Biopharma QC Workflows: LC/UV Versus Single Quadrupole…
Key words
contents, contentstable, tablemass, masspro, proplus, plusabundance, abundancetrastuzumab, trastuzumabmoera, moeraunknown, unknownrelative, relativeabundances, abundancesagilent, agilentmoerc, moercmoe, moethreshold
Monitoring Stability and Impurity Products of GLP-1 Agonists Using a Novel Single Quadrupole LC/MS
2025|Agilent Technologies|Posters
Poster Reprint ASMS 2025 Poster number TP 644 Monitoring Stability and Impurity Products of GLP-1 Agonists Using a Novel Single Quadrupole LC/MS Mahsan Miladi , Behrooz Zekavat Agilent Technologies, Santa Clara, CA, USA Introduction Experimental Glucagon-like peptide-1 (GLP-1) receptor agonists,…
Key words
semaglutide, semaglutideoxidation, oxidationtirzepatide, tirzepatidetirazeptide, tirazeptideimpurity, impurityplus, pluspro, proimpurities, impuritiesmono, monoagilent, agilentrelated, relatedincretin, incretinrld, rldgip, gipaib
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance
Therapeutic Peptide Analysis of GLP‑1 Agonists
2026|Agilent Technologies|Applications
Application Note Biopharma Therapeutic Peptide Analysis of GLP‑1 Agonists Using an Agilent Altura Peptide Plus column and an Agilent InfinityLab Pro iQ Plus Author Abstract Suresh Babu C.V. Agilent Technologies, Inc. The biopharmaceutical industry requires analytical control of synthetic peptide…
Key words
altura, alturapeptide, peptideplus, pluscounts, countsliraglutide, liraglutideresponse, responseimpurity, impurityagilent, agilentpro, propeptides, peptidestirzepatide, tirzepatideretention, retentionmin, mincolumn, columninfinitylab