Workflow Solutions for Peptide Therapeutics - Application Compendium
Guides | 2025 | Agilent TechnologiesInstrumentation
The rapid emergence of peptide-based therapeutics, particularly GLP-1 agonists for diabetes and obesity, has driven the need for robust analytical methods. Peptides offer high specificity, low toxicity, and favorable safety profiles, but their complexity and manufacturing impurities demand comprehensive workflows to ensure quality, efficacy, and regulatory compliance.
This compendium collates state-of-the-art analytical solutions for synthetic and recombinant peptide therapeutics. It outlines key quality attributes, impurity types, and end-to-end Agilent workflows—from raw material verification and purification to identity confirmation, impurity profiling, stability assessment, and bioanalysis—supported by real-world application notes.
A variety of separation, spectroscopic, and mass-spectrometric techniques are integrated into tailored workflows:
A suite of application notes demonstrates method development and performance metrics across workflows:
These integrated workflows provide:
As interest in peptide therapeutics expands, future developments will focus on:
Agilent’s comprehensive portfolio—from innovative columns and LC/MS platforms to automated sample prep, spectroscopy, and data management—offers reliable, scalable, and regulatory-compliant solutions for the full analytical lifecycle of peptide therapeutics. These workflows empower researchers and QC labs to address complex challenges in peptide drug development and ensure consistent product quality.
HPLC, LC/MS, Capillary electrophoresis, PrepLC, LC/SQ, RAMAN Spectroscopy, FTIR Spectroscopy, UV–VIS spectrophotometry, 2D-LC, ICP/MS, LC/MS/MS, LC/TOF, LC/HRMS, LC/QQQ, GC, GC/MSD, GC/SQ, HeadSpace, GPC/SEC, Consumables, LC columns
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Significance of the Topic
The rapid emergence of peptide-based therapeutics, particularly GLP-1 agonists for diabetes and obesity, has driven the need for robust analytical methods. Peptides offer high specificity, low toxicity, and favorable safety profiles, but their complexity and manufacturing impurities demand comprehensive workflows to ensure quality, efficacy, and regulatory compliance.
Objectives and Overview of the Article
This compendium collates state-of-the-art analytical solutions for synthetic and recombinant peptide therapeutics. It outlines key quality attributes, impurity types, and end-to-end Agilent workflows—from raw material verification and purification to identity confirmation, impurity profiling, stability assessment, and bioanalysis—supported by real-world application notes.
Methods and Instrumentation
A variety of separation, spectroscopic, and mass-spectrometric techniques are integrated into tailored workflows:
- Chromatography: RP-LC/UV, RP-LC/MS, 2D-LC, SEC, HILIC
- Mass spectrometry: LC/Q-TOF, LC/TQ, IM/MS, ECD fragmentation
- Spectroscopy: Raman, FTIR, UV-Vis
- Sample prep: automated derivatization (AAA), solid-phase prep (AssayMAP), preparative LC
- Supporting tools: residual solvent GC/HS, ICP-MS, endotoxin assays, microbial counts
Key Instrumentation
- Agilent 1290 Infinity II/III LC and autoscale preparative systems
- AdvanceBio LC columns (Peptide Plus, Peptide Mapping, SEC)
- 6545XT AdvanceBio LC/Q-TOF with ExD cell
- 6495D Triple Quadrupole LC/MS, InfinityLab LC/MSD (iQ, XT)
- Vaya Raman, Cary FTIR, RapID system
- AssayMAP Bravo and AssayMAP cartridges
- Seahorse XF, xCELLigence RTCA eSight, Cytation C10, NovoCyte flow cytometers
- SLIMS LIMS/ELN software
- CrossLab Services for qualification, maintenance, and training
Main Results and Discussion
A suite of application notes demonstrates method development and performance metrics across workflows:
- Peptide purification and scale-up on PLRP-S columns with direct method transfer from analytical to preparative scale
- Comprehensive sequence and PTM mapping of GLP-1 analogs via ECD-enabled LC/Q-TOF and ExDViewer
- Aggregate profiling using bio-2D-LC with active solvent modulation for MS-compatible SEC analysis
- Quantitative MRM methods for native and oxidized tirzepatide, achieving low-ng/mL LOQs with high precision
- Amino acid composition analysis by automated OPA derivatization and bio-LC for semaglutide and liraglutide
- Stability-induced impurity identification by forced-degradation studies and deconvolution in OpenLab CDS
- Rapid intact mass confirmation of peptides using deconvolution-enabled LC/MSD iQ scans up to m/z 1,450
- Raw material identity verification through-container by Raman spectroscopy for Fmoc-protected amino acids
Benefits and Practical Applications
These integrated workflows provide:
- Regulatory-compliant QC for USP/ICH and pharmacopeial chapters (e.g., USP <1503>, Ph. Eur.)
- High throughput and automation for routine bioanalysis and method transfer
- Enhanced sensitivity, selectivity, and robustness for impurity and aggregate profiling
- Seamless scale-up from early research to manufacturing QC
- Comprehensive LIMS/ELN and support services to maintain data integrity and instrument uptime
Future Trends and Opportunities
As interest in peptide therapeutics expands, future developments will focus on:
- Advanced ion mobility and fragmentation techniques for deeper structural insights
- Integration of machine learning and AI to accelerate method development and data interpretation
- Microfluidics and miniaturized LC/MS for high-throughput screening
- Enhanced bioinformatics and cloud-based LIMS for real-time QC monitoring
- Novel sample prep platforms for next-generation conjugates and multi-specific peptides
Conclusion
Agilent’s comprehensive portfolio—from innovative columns and LC/MS platforms to automated sample prep, spectroscopy, and data management—offers reliable, scalable, and regulatory-compliant solutions for the full analytical lifecycle of peptide therapeutics. These workflows empower researchers and QC labs to address complex challenges in peptide drug development and ensure consistent product quality.
Reference
- Omics Online. Biological Activities of GLP-1.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
End-To-End Workflow Solutions for Therapeutic Peptides
2025|Agilent Technologies|Brochures and specifications
Therapeutic Peptides Workflow Resource Guide End-To-End Workflow Solutions for Therapeutic Peptides From research discovery to production QA/QC Ensuring Quality in Therapeutic Peptide Development Peptides are short chains of amino acids, which are the "building blocks" of proteins. Some peptide molecules…
Key words
peptide, peptideopenlab, openlabbundle, bundlesoftware, softwareworkflow, workflowadvancebio, advancebiochemstation, chemstationmsd, msdpreparative, preparativeanalysis, analysisagilent, agilentvaya, vayadetect, detectimpurity, impuritypurification
Peptide Drug Stability Analysis Using Agilent InfinityLab LC/MSD and OpenLab CDS Deconvolution
2024|Agilent Technologies|Applications
Application Note Biopharmaceuticals Peptide Drug Stability Analysis Using Agilent InfinityLab LC/MSD and OpenLab CDS Deconvolution Author Chae-Young Ryu Agilent Technologies, Inc. Abstract The Federal Drug Administration (FDA) abbreviated new drug application (ANDA) guidelines advise qualitative and quantitative management of peptide-related…
Key words
abundance, abundancecounts, countsliraglutide, liraglutideimpurities, impuritiesinfinitylab, infinitylabsemaglutide, semaglutiderelative, relativemass, masspeptide, peptidemsd, msdcharge, chargedegradation, degradationdrug, drugmin, minanda
Rapid Confirmation of GLP-1 Analog (Liraglutide) Using Agilent InfinityLab LC/MSD iQ
2024|Agilent Technologies|Brochures and specifications
Application Note Biopharmaceuticals Rapid Confirmation of GLP-1 Analog (Liraglutide) Using Agilent InfinityLab LC/MSD iQ Author Abstract Chae-Young Ryu Agilent Technologies, Inc. This application note presents the analysis of liraglutide using the Agilent InfinityLab LC/MSD iQ. When rapid molecular weight confirmation…
Key words
advancebio, advancebiopeptide, peptidedifluoroacetic, difluoroaceticacid, acidmapping, mappingtrifluoroacetic, trifluoroaceticliraglutide, liraglutideagilent, agilentinfinitylab, infinitylabmsd, msdacidic, acidicformic, formictfa, tfacolumn, columnmodifier