Peptide Drug Stability Analysis Using Agilent InfinityLab LC/MSD and OpenLab CDS Deconvolution

Applications | 2024 | Agilent TechnologiesInstrumentation
LC/MS, LC/SQ, Software
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the Topic


Therapeutic peptides such as GLP-1 agonists play an increasingly important role in biopharmaceuticals. Due to their complex structure and susceptibility to chemical modifications, peptide drugs can form impurities that may affect safety and efficacy. Regulatory agencies require detailed impurity profiling to minimize immunogenic risks and ensure consistent product quality.

Objectives and Study Overview


This study aims to evaluate a forced degradation workflow for two GLP-1 agonist peptides, liraglutide and semaglutide, under acidic, basic, and oxidative stress. Key goals include separation of degradation products, determination of their nominal masses, and demonstration of a streamlined data analysis using single quadrupole mass spectrometry combined with software deconvolution.

Methodology and Instrumentation


Samples of liraglutide and semaglutide were subjected to the following stress conditions at elevated temperature:
  • Acidic hydrolysis (0.1 M HCl)
  • Basic hydrolysis (0.1 M NaOH)
  • Oxidative degradation (0.2% hydrogen peroxide)
Aliquots were taken at defined time points, neutralized, and analyzed by reversed-phase liquid chromatography in gradient mode. An Agilent 1260 Infinity II Prime Bio LC system with AdvanceBio Peptide Mapping and InfinityLab Poroshell EC-C18 columns provided chromatographic separation. Detection was carried out using Agilent InfinityLab LC/MSD iQ and XT single quadrupole mass spectrometers in positive electrospray mode. Spectral deconvolution for neutral mass assignment was performed with Agilent OpenLab CDS version 2.8.

Main Results and Discussion


Initial chromatograms revealed coelution of some impurities with the main peptide peak. Resolution was enhanced by extending the column length through series connection of 100 and 150 mm Poroshell columns and employing a shallow gradient slope. Forced degradation profiles showed distinct impurity patterns for each stress condition, with acid and oxidative treatments generating the most diverse peaks. Deconvolution successfully converted multiply charged ion envelopes into nominal masses, identifying major degradation products of liraglutide and semaglutide and revealing specific mass differences relative to the parent compounds.

Practical Benefits and Applications


This workflow offers several advantages for peptide drug development and quality control:
  • Use of single quadrupole MS reduces operational complexity and cost
  • Software deconvolution simplifies mass confirmation without high-resolution instruments
  • Flexible column configuration allows rapid optimization of separation
  • Applicable for early formulation screening and routine stability testing

Future Trends and Opportunities


Emerging directions include integration of high-resolution MS for detailed structural elucidation, advanced data processing algorithms for automated impurity classification, and online coupling with peptide mapping techniques. Expansion to more complex peptide conjugates and multi peptide formulations will further strengthen the robustness of forced degradation analysis.

Conclusion


The combination of Agilent InfinityLab LC/MSD single quadrupole systems, versatile column configurations, and OpenLab CDS deconvolution provides a user friendly and efficient platform for forced degradation studies of peptide therapeutics. This approach meets regulatory requirements for impurity profiling while maintaining ease of use for late-stage development and routine quality control.

Reference


  • FDA Guidance ANDAs for Certain Highly Purified Synthetic Peptide Drug Products That Refer to Listed Drugs for rDNA Origin, 2021
  • Ame S et al Influence of Production Process and Scale on Quality of Polypeptide Drugs A Case Study on GLP-1 Analogs Pharm Res 2020 37 120
  • Brian R Jarod G Unit Mass Spectral Deconvolution for Molecular Weight Confirmation of Large Molecules Agilent Technologies Technical Overview 5994-6928EN 2024

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Workflows for GLP-1 Receptor Agonists and Therapeutic Peptides: Identity, Impurity, Bioanalysis, and Stability Testing
Agilent biopharma solutions Workflows for GLP-1 Receptor Agonists and Therapeutic Peptides: Identity, Impurity, Bioanalysis, and Stability Testing Contents Raw Material Purity and Impurity Identification Analysis Bioanalysis Stability Testing Studies Contents Introduction 02 1 Raw Material Identification 03 1.1 Verification…
Key words
bioanalysis, bioanalysisimpurity, impurityraw, rawstudies, studiespurity, puritycontents, contentsstability, stabilitytesting, testingmaterial, materialidentification, identificationexenatide, exenatidetirzepatide, tirzepatidesemaglutide, semaglutidepeptide, peptideliraglutide
Characterization of Synthetic Peptide Drug and Impurities using High-Performance Liquid Chromatography (HPLC) and Liquid Chromatography/Mass Spectrometry (LC/MS)
Characterization of Synthetic Peptide Drug and Impurities using High-Performance Liquid Chromatography (HPLC) and Liquid Chromatography/Mass Spectrometry (LC/MS) 1D Column Column Agilent AdvanceBio Peptide Mapping 120Å, 2.1 x 150mm, 2.7 µm 0.4 mL/min Injection volume 20 μL Column temperature A) B)…
Key words
daltons, daltonsozempic, ozempicabundance, abundancesemaglutide, semaglutidemass, massamino, aminoopa, opasynthetic, syntheticcounts, countstime, timesource, sourcemin, minacid, acidinfinitylab, infinitylabapi
Confirmation of Peptide-Related Impurity Intact Mass Using Agilent 1290 Infinity II Bio 2D-LC and InfinityLab LC/MSD XT
Application Note Biopharmaceuticals Confirmation of Peptide-Related Impurity Intact Mass Using Agilent 1290 Infinity II Bio 2D-LC and InfinityLab LC/MSD XT Author Chae-Young Ryu Agilent Technologies, Inc. Abstract This application note presents the analysis of peptide-related impurities for Semaglutide using an…
Key words
abundance, abundancesemaglutide, semaglutiderelative, relativemass, massimpurities, impuritiespeptide, peptidemin, mintime, timedegradation, degradationmau, maumsd, msdweights, weightsdaltons, daltonsthreshold, thresholdcut
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike