End-To-End Workflow Solutions for Therapeutic Peptides
Brochures and specifications | 2025 | Agilent TechnologiesInstrumentation
Therapeutic peptides, short chains of up to 40 amino acids, bridge the gap between small-molecule drugs and biologics. Their high receptor specificity and favorable safety profiles drive rapid growth in metabolic disease treatments. However, challenges such as metabolic instability, low bioavailability, and complex impurity profiles demand rigorous analytical strategies throughout discovery, development, and manufacturing.
This guide presents end-to-end workflow solutions for therapeutic peptide development, illustrating methods for raw material identification, purity and impurity profiling, sequence confirmation, preparative purification, quantitation in biological matrices, and finished product quality control. It emphasizes regulatory compliance with FDA, USP, and ICH guidelines, aiming to ensure robust QA/QC and streamline peptide drug production.
A multimodal analytical toolkit covers spectroscopic, chromatographic, and mass-spectrometric techniques:
Integrated Agilent workflows demonstrate:
These workflows enhance peptide drug development by ensuring regulatory compliance, improving throughput, reducing method development time, and delivering consistent, high-quality data across R&D, manufacturing, and QA/QC laboratories.
Emerging directions include increased automation and microfluidic integration, AI-driven data analysis, advanced ion mobility separations, and expansion of workflows to novel peptide modalities and complex biologics.
Robust, end-to-end analytical strategies are essential for advancing therapeutic peptides from discovery to market. The described Agilent workflows offer comprehensive, scalable solutions that address critical quality attributes at every stage, supporting innovation and regulatory compliance.
HPLC, LC/TOF, LC/HRMS, LC/MS/MS, LC/MS, LC columns, Consumables, Software, GC/MS/MS, ICP/MS, UV–VIS spectrophotometry
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Significance of the Topic
Therapeutic peptides, short chains of up to 40 amino acids, bridge the gap between small-molecule drugs and biologics. Their high receptor specificity and favorable safety profiles drive rapid growth in metabolic disease treatments. However, challenges such as metabolic instability, low bioavailability, and complex impurity profiles demand rigorous analytical strategies throughout discovery, development, and manufacturing.
Objectives and Study Overview
This guide presents end-to-end workflow solutions for therapeutic peptide development, illustrating methods for raw material identification, purity and impurity profiling, sequence confirmation, preparative purification, quantitation in biological matrices, and finished product quality control. It emphasizes regulatory compliance with FDA, USP, and ICH guidelines, aiming to ensure robust QA/QC and streamline peptide drug production.
Methodology and Instrumentation
A multimodal analytical toolkit covers spectroscopic, chromatographic, and mass-spectrometric techniques:
- Raw material identification via handheld Raman (Agilent Vaya), FTIR (Cary 630), or HPLC (1290 Infinity III bio LC).
- Purity analysis by LC/UV and LC/MS using reversed-phase columns, single-quad and time-of-flight MS (6230B TOF LC/MS, InfinityLab LC/MSD XT).
- Amino acid composition via precolumn derivatization and HILIC LC/MS (AdvanceBio AAA).
- Impurity and aggregation profiling by 1D/2D-LC coupled with Q-TOF and MS/TOF systems for high-resolution mass analysis.
- Sequence confirmation and isomer characterization using ExD dissociation on the 6545XT LC/Q-TOF and ion mobility separation on the 6560C IM-Q-TOF.
- Preparative-scale peptide purification with analytical and preparative LC systems (1260/1290 Infinity II) and compatible reversed-phase columns.
- Quantitative peptide assays in plasma using automated sample prep (AssayMAP Bravo), nano-flow LC, and triple quadrupole MS (6495D LC/TQ).
- Finished product QC by UV-Vis spectroscopy (Cary 3500 Multicell UV-Vis).
- Trace elemental impurity analysis by ICP-MS (7850 or 7900) and residual solvent testing by headspace GC or GC/MS (8890 GC, 8697 HS).
Main Results and Discussion
Integrated Agilent workflows demonstrate:
- Rapid, through-container raw material verification with handheld Raman, preserving container integrity.
- High-sensitivity peptide purity and impurity mapping, enabling detection of diastereomers, oxidation products, and sequence variants.
- Automated amino acid analysis with low detection limits and high throughput.
- Advanced MS/MS and ion mobility methods to resolve isomeric species and confirm complex modifications.
- Scalable preparative LC solutions achieving high recovery and purity across analytical to production scales.
- Reproducible quantitative assays in challenging matrices, complying with pharmacokinetic study requirements.
- Comprehensive QC tools for elemental and solvent impurities aligned with USP<232>/<467> and ICH Q3D.
Benefits and Practical Applications
These workflows enhance peptide drug development by ensuring regulatory compliance, improving throughput, reducing method development time, and delivering consistent, high-quality data across R&D, manufacturing, and QA/QC laboratories.
Future Trends and Possibilities for Application
Emerging directions include increased automation and microfluidic integration, AI-driven data analysis, advanced ion mobility separations, and expansion of workflows to novel peptide modalities and complex biologics.
Conclusion
Robust, end-to-end analytical strategies are essential for advancing therapeutic peptides from discovery to market. The described Agilent workflows offer comprehensive, scalable solutions that address critical quality attributes at every stage, supporting innovation and regulatory compliance.
References
- Tripodi A, Coffey A. An In-Depth Analysis of Semaglutide, a Glucagon-Like Peptide-1 Receptor Agonist. Agilent Technologies Application Note 5994-7419EN, 2024.
- Ryu CY. Rapid Confirmation of GLP-1 Analog (Liraglutide) Using Agilent InfinityLab LC/MSD iQ. Agilent Technologies Application Note 5994-7415EN, 2024.
- Ryu CY. Efficient Method Optimization of Semaglutide Analysis Using an Agilent 1260 Infinity II Bio Prime LC System and Blend Assist. Agilent Technologies Application Note 5994-7414EN, 2024.
- Ahmad S, Singh N, Pargaonkar A. LC-MS Based Characterization Workflow of GLP-1 Therapeutic Peptide Liraglutide and Its Impurities. Agilent Technologies Application Note 5994-7727EN, 2024.
- Franklin R, Meeuwsen J. Identification of Amino Acid Isomers Using Electron Capture Dissociation in the Agilent 6545XT AdvanceBio LC/Q-TOF System. Agilent Technologies Application Note 5994-7506EN, 2024.
- Babu S. Characterization of Forced Degradation Impurities of GLP-1 Agonists by LC Q-TOF MS. Agilent Technologies Application Note 5994-7794EN, 2024.
- Ryu CY. Confirmation of Peptide-Related Impurity Intact Mass Using Agilent 1290 Infinity II Bio 2D-LC and InfinityLab LC MSD XT. Agilent Technologies Application Note 5994-7654EN, 2024.
- Ryu CY. Comprehensive Aggregate Profiling of Liraglutide and Semaglutide Using an Agilent 1290 Infinity II Bio 2D-LC and Agilent InfinityLab LC-MSD XT. Agilent Technologies Application Note 5994-7740EN, 2024.
- Babu S. Quantification of Glucagon-Like Peptide-1 Agonist Tirzepatide Using an Agilent 6495D Triple Quadrupole LC/MS System. Agilent Technologies Application Note 5994-7992EN, 2024.
- Qiu X. Quantification of Therapeutic Peptide Exenatide in Rat Plasma. Agilent Technologies Application Note 5994-5224EN, 2022.
- Ryu CY. Amino Acid Composition Test of Semaglutide and Liraglutide Using an Agilent 1260 Infinity II Prime Bio LC. Agilent Technologies Application Note 5994-7749EN, 2024.
- Welsby C, Grise S, Prulliere F. Verification of Raw Materials for Synthetic Peptide Production with the Agilent Vaya Raman System. Agilent Technologies Application Note 5994-7610EN, 2024.
- Amino Acid Analysis – ‘How-To’ Guide. Agilent Technologies Application Note 5991-7694EN, 2021.
- Data Integrity Options for GxP Facilities: For Agilent ICP-MS and ICP-QQQ Spectrometers. Agilent Technologies Flyer 5994-4746EN, 2022.
- Sanderson J, Whitecotton L. Analysis of Artificial Tear Eye Drops for Elemental Impurities. Agilent Technologies Application Note 5994-1561EN, 2022.
- Whitecotton L, McCurdy E, Jones C, Liba A. Validating Performance of an Agilent ICP-MS for USP<232>/<233> & ICH Q3D(R2)/Q2(R1). Agilent Technologies Application Note 5991-8335EN, 2022.
- USP <232>/<233> and ICH Q3D Elemental Impurities Analysis: The Agilent ICP-MS Solution. Agilent Technologies White Paper 5991-8149EN, 2021.
- Measuring Elemental Impurities in Pharmaceutical Materials. Agilent Technologies Brochure 5991-8140EN, 2022.
- Dhuria RS, Jain V, Kapadnis G, Vyas S. Determining Elemental Impurities in Pharmaceutical Ingredients Using ICP-MS. Agilent Technologies Application Note 5991-7674EN, 2021.
- Sanderson J. Residual Solvent Analysis in Hemp Consumer Products Using Headspace Gas Chromatography and Mass Spectrometry. Agilent Technologies Application Note 5994-5237EN, 2022.
- Zhang Y, Na S. Analysis of USP <467> Residual Solvents of Class 1, Class 2, and Class 3 Using the Agilent 8890 GC/FID/5977B MSD System. Agilent Technologies Application Note 5994-1488EN, 2019.
- Wieder L, Pan J, Veeneman R. Analysis of USP Method <467> Residual Solvents on the Agilent 8890 GC System. Agilent Technologies Application Note 5994-0442EN, 2019.
- Residual Solvents Analysis Using an Agilent Intuvo 9000 GC System. Agilent Technologies Application Note 5991-9029EN, 2018.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
End-to-End Workflow Solutions for Oligonucleotide Analysis
2023|Agilent Technologies|Guides
Oligo Workflow Resource Guide End-to-End Workflow Solutions for Oligonucleotide Analysis From research discovery to production QA/QC Synthetic oligonucleotides are widely used in research and genetic testing. This class of short nucleic acid polymers includes small interfering RNA, antisense oligonucleotides, aptamers,…
Key words
oligonucleotide, oligonucleotidepurification, purificationopenlab, openlabadvancebio, advancebiooligonucleotides, oligonucleotidessequence, sequencechemstation, chemstationpreparative, preparativeagilent, agilentimpurities, impuritiesplrp, plrpbundle, bundlesax, saxworkflow, workflowprep
Workflow Solutions for Peptide Therapeutics - Application Compendium
2025|Agilent Technologies|Guides
Workflow Solutions for Peptide Therapeutics Application Compendium Table of Contents Introduction4 An emerging class of peptide therapeutics: GLP-15 Analytical advances in peptide therapeutics5 Key analyses for synthetic and recombinant peptide therapeutics 6 Types of impurities in peptide therapeutics 7 Agilent…
Key words
peptide, peptidereturn, returncontents, contentsadvancebio, advancebiotable, tableliraglutide, liraglutideagilent, agilentanalysis, analysisinfinitylab, infinitylabsemaglutide, semaglutideimpurities, impuritiessynthetic, syntheticmsd, msdtherapeutics, therapeuticsnotes
End-To-End Spectroscopy-Based Workflow Solutions for Oligonucleotide Analysis
2023|Agilent Technologies|Brochures and specifications
Oligo Workflow Resource Guide End-To-End Spectroscopy-Based Workflow Solutions for Oligonucleotide Analysis From research discovery to production QA/QC Synthetic oligonucleotides are widely used in research and genetic testing. This class of short nucleic acid polymers includes small interfering RNA, antisense oligonucleotides,…
Key words
vaya, vayaicp, icpbundle, bundlesoftware, softwareelemental, elementalvis, visresidual, residualagilent, agilentftir, ftiropenlab, openlabmicrolab, microlabbased, basedcary, carycalibrate, calibrateanalysis
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance