Using Agilent Certified Pre-Owned Instruments to Research the Prediction of Covid-19 | LabRulez LCMS
 

Similar PDF

Toggle
Application NoteComprehending COVID-19: StructuralCharacterization of the Glycan Assemblies ofO-linked Glycopeptides Using Cyclic IonMobilityLindsay MorrisonWaters Corporation, Georgetown University Medical Center, Lombardi Comprehensive CancerCenterFor research use only. Not for use indiagnostic procedures.Save 15% off on Columns, Consumables and Spare Parts on Waters.com....
Key words
cyclic, cyclicims, imsfurin, furinglycan, glycanlinked, linkedmobility, mobilitycleavage, cleavageglycosylation, glycosylationselect, selectseries, seriesspike, spikeglycopeptides, glycopeptidessite, siteefforts, effortstri
TECHNICAL NOTE000055A quick and robust mass spectrometry-basedmethod for the detection of SARS-CoV-2Authors: Richard J. Gibson1, Stephanie N.Samra1, Kerry M. Hassell1, George A.Renney2, Bradley J. Hart11Thermo Fisher Scientific, San Jose, CA, US2Thermo Fisher Scientific, HemelHempstead, United KingdomKeywords: TSQ Altis MD MS,...
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE65974LC-MS for detection of SARS-CoV-2viral and host proteinsAuthors: Kruthi Suvarna1,Medha Gayathri J Pai1, Sanjeeva Srivastava1,Debadeep Bhattacharyya2, Kerry Hassell2Indian Institute of Technology, Bombay,Powai, Mumbai, India2Thermo Fisher Scientific,San Jose, CA, USA1Keywords: COVID-19, SARS-CoV-2,host response, nasopharyngeal, plasma,mass spectrometry, omics, TSQ Altis,Orbitrap Fusion...
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkcovid, covidaltis
An urgent need for expanded virus research
2020|Thermo Fischer Scientific|Technical notes
WHITE PAPER65880An urgent need for expanded virus researchThe role of mass spectrometry in understandingvirus structure and functionIf we needed any additional evidence that virus researchis an important area to emphasize, the severe acuterespiratory syndrome coronavirus 2 (SARS-CoV-2)pandemic and cumulative COVID-19...
Key words
virus, virusviral, viralprotein, proteinhost, hostimmune, immuneinteractions, interactionsproteins, proteinsmhc, mhchdx, hdxglycosylation, glycosylationvaccine, vaccinecell, cellmembrane, membranestructural, structuralpeptides
 

Similar PDF

Toggle
Application NoteComprehending COVID-19: StructuralCharacterization of the Glycan Assemblies ofO-linked Glycopeptides Using Cyclic IonMobilityLindsay MorrisonWaters Corporation, Georgetown University Medical Center, Lombardi Comprehensive CancerCenterFor research use only. Not for use indiagnostic procedures.Save 15% off on Columns, Consumables and Spare Parts on Waters.com....
Key words
cyclic, cyclicims, imsfurin, furinglycan, glycanlinked, linkedmobility, mobilitycleavage, cleavageglycosylation, glycosylationselect, selectseries, seriesspike, spikeglycopeptides, glycopeptidessite, siteefforts, effortstri
TECHNICAL NOTE000055A quick and robust mass spectrometry-basedmethod for the detection of SARS-CoV-2Authors: Richard J. Gibson1, Stephanie N.Samra1, Kerry M. Hassell1, George A.Renney2, Bradley J. Hart11Thermo Fisher Scientific, San Jose, CA, US2Thermo Fisher Scientific, HemelHempstead, United KingdomKeywords: TSQ Altis MD MS,...
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE65974LC-MS for detection of SARS-CoV-2viral and host proteinsAuthors: Kruthi Suvarna1,Medha Gayathri J Pai1, Sanjeeva Srivastava1,Debadeep Bhattacharyya2, Kerry Hassell2Indian Institute of Technology, Bombay,Powai, Mumbai, India2Thermo Fisher Scientific,San Jose, CA, USA1Keywords: COVID-19, SARS-CoV-2,host response, nasopharyngeal, plasma,mass spectrometry, omics, TSQ Altis,Orbitrap Fusion...
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkcovid, covidaltis
An urgent need for expanded virus research
2020|Thermo Fischer Scientific|Technical notes
WHITE PAPER65880An urgent need for expanded virus researchThe role of mass spectrometry in understandingvirus structure and functionIf we needed any additional evidence that virus researchis an important area to emphasize, the severe acuterespiratory syndrome coronavirus 2 (SARS-CoV-2)pandemic and cumulative COVID-19...
Key words
virus, virusviral, viralprotein, proteinhost, hostimmune, immuneinteractions, interactionsproteins, proteinsmhc, mhchdx, hdxglycosylation, glycosylationvaccine, vaccinecell, cellmembrane, membranestructural, structuralpeptides
 

Related content

Simultaneous analysis of drug substances according to USP assay and impurity methods

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

Matrix Matching or Isotope Dilution? A Comparison of Two Quantitation Approaches to Determine PFAS in Dairy Milk

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Food & Agriculture

Food Metabolomics of Alcoholic Beverage Using Single-Quadrupole Mass Spectrometer — Oligosaccharide and Polysaccharide Profiling —

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

Demonstrating the Applicability of the ACQUITY™ Premier Binary System for Long Shallow Gradient Peptide Mapping Analysis

Applications
| 2022 | Waters
Instrumentation
HPLC
Manufacturer
Waters
Industries
Proteomics

Qualitative Analysis of the Components in Foods Using DART and the Quadrupole Time- of-flight Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, DART
Manufacturer
Shimadzu
Industries
Food & Agriculture
 

Related content

Simultaneous analysis of drug substances according to USP assay and impurity methods

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

Matrix Matching or Isotope Dilution? A Comparison of Two Quantitation Approaches to Determine PFAS in Dairy Milk

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Food & Agriculture

Food Metabolomics of Alcoholic Beverage Using Single-Quadrupole Mass Spectrometer — Oligosaccharide and Polysaccharide Profiling —

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

Demonstrating the Applicability of the ACQUITY™ Premier Binary System for Long Shallow Gradient Peptide Mapping Analysis

Applications
| 2022 | Waters
Instrumentation
HPLC
Manufacturer
Waters
Industries
Proteomics

Qualitative Analysis of the Components in Foods Using DART and the Quadrupole Time- of-flight Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, DART
Manufacturer
Shimadzu
Industries
Food & Agriculture
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.