Using Agilent Certified Pre-Owned Instruments to Research the Prediction of Covid-19 | LabRulez LCMS_EN
 

Similar PDF

Toggle
Application NoteComprehending COVID-19: StructuralCharacterization of the Glycan Assemblies ofO-linked Glycopeptides Using Cyclic IonMobilityLindsay MorrisonWaters Corporation, Georgetown University Medical Center, Lombardi Comprehensive CancerCenterFor research use only. Not for use indiagnostic procedures.Save 15% off on Columns, Consumables and Spare Parts on Waters.com....
Key words
cyclic, cyclicims, imsfurin, furinglycan, glycanlinked, linkedmobility, mobilitycleavage, cleavageglycosylation, glycosylationselect, selectseries, seriesspike, spikeglycopeptides, glycopeptidessite, siteefforts, effortstri
Recombinant SARS-CoV-2 Receptor Binding Domain:Comprehensive Top-Down Sequence Confirmation,Curation and O-Glycosylation Site DeterminationKnow your SARS-CoV-2 antigen structure before it´s use in research and diagnosticsAbstractThe COVID pandemic dramatically influences our life andthe demand remains very highfor recombinant SARS-CoV-2surface proteins for diagnostics,vaccinedevelopmentandresearch. The...
Key words
maldi, maldirbd, rbdisd, isdglycosylation, glycosylationbruker, brukerrbds, rbdsterminal, terminalsialexo, sialexosequence, sequencedown, downspectra, spectrapngase, pngasecho, chocompass, compasstop
TECHNICAL NOTE000055A quick and robust mass spectrometry-basedmethod for the detection of SARS-CoV-2Authors: Richard J. Gibson1, Stephanie N.Samra1, Kerry M. Hassell1, George A.Renney2, Bradley J. Hart11Thermo Fisher Scientific, San Jose, CA, US2Thermo Fisher Scientific, HemelHempstead, United KingdomKeywords: TSQ Altis MD MS,...
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE65974LC-MS for detection of SARS-CoV-2viral and host proteinsAuthors: Kruthi Suvarna1,Medha Gayathri J Pai1, Sanjeeva Srivastava1,Debadeep Bhattacharyya2, Kerry Hassell2Indian Institute of Technology, Bombay,Powai, Mumbai, India2Thermo Fisher Scientific,San Jose, CA, USA1Keywords: COVID-19, SARS-CoV-2,host response, nasopharyngeal, plasma,mass spectrometry, omics, TSQ Altis,Orbitrap Fusion...
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkcovid, covidaltis
 

Similar PDF

Toggle
Application NoteComprehending COVID-19: StructuralCharacterization of the Glycan Assemblies ofO-linked Glycopeptides Using Cyclic IonMobilityLindsay MorrisonWaters Corporation, Georgetown University Medical Center, Lombardi Comprehensive CancerCenterFor research use only. Not for use indiagnostic procedures.Save 15% off on Columns, Consumables and Spare Parts on Waters.com....
Key words
cyclic, cyclicims, imsfurin, furinglycan, glycanlinked, linkedmobility, mobilitycleavage, cleavageglycosylation, glycosylationselect, selectseries, seriesspike, spikeglycopeptides, glycopeptidessite, siteefforts, effortstri
Recombinant SARS-CoV-2 Receptor Binding Domain:Comprehensive Top-Down Sequence Confirmation,Curation and O-Glycosylation Site DeterminationKnow your SARS-CoV-2 antigen structure before it´s use in research and diagnosticsAbstractThe COVID pandemic dramatically influences our life andthe demand remains very highfor recombinant SARS-CoV-2surface proteins for diagnostics,vaccinedevelopmentandresearch. The...
Key words
maldi, maldirbd, rbdisd, isdglycosylation, glycosylationbruker, brukerrbds, rbdsterminal, terminalsialexo, sialexosequence, sequencedown, downspectra, spectrapngase, pngasecho, chocompass, compasstop
TECHNICAL NOTE000055A quick and robust mass spectrometry-basedmethod for the detection of SARS-CoV-2Authors: Richard J. Gibson1, Stephanie N.Samra1, Kerry M. Hassell1, George A.Renney2, Bradley J. Hart11Thermo Fisher Scientific, San Jose, CA, US2Thermo Fisher Scientific, HemelHempstead, United KingdomKeywords: TSQ Altis MD MS,...
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE65974LC-MS for detection of SARS-CoV-2viral and host proteinsAuthors: Kruthi Suvarna1,Medha Gayathri J Pai1, Sanjeeva Srivastava1,Debadeep Bhattacharyya2, Kerry Hassell2Indian Institute of Technology, Bombay,Powai, Mumbai, India2Thermo Fisher Scientific,San Jose, CA, USA1Keywords: COVID-19, SARS-CoV-2,host response, nasopharyngeal, plasma,mass spectrometry, omics, TSQ Altis,Orbitrap Fusion...
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkcovid, covidaltis
 

Related content

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Applications
| 2022 | Shimadzu
Instrumentation
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Posters
| 2022 | Waters
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Waters
Industries
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Applications
| 2022 | Shimadzu
Instrumentation
Ion chromatography
Manufacturer
Shimadzu
Industries
Environmental
 

Related content

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Applications
| 2022 | Shimadzu
Instrumentation
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Posters
| 2022 | Waters
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Waters
Industries
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Applications
| 2022 | Shimadzu
Instrumentation
Ion chromatography
Manufacturer
Shimadzu
Industries
Environmental
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.