Using Agilent Certified Pre-Owned Instruments to Research the Prediction of Covid-19Others | 2021 | Agilent TechnologiesInstrumentationGC/MSD, LC/MS, LC/MS/MS, LC/QQQIndustriesClinical ResearchManufacturerAgilent TechnologiesKey wordsdenina, cpo, owned, wastewater, simmons, her, proteins, she, assistant, virus, professor, program, measure, exactly, refurbishes, pre, research, university, forecast, stewardship, directors, officials, outbreak, certified, september, spectrometer, had, cities, researching, trajectory, agilent, ontario, mass, tof, what, said, upgrading, those, genes, began, tech, centers, quadruple, buy, accept, instruments, plans, chromatography, biology, mind
Similar PDF
Comprehending COVID-19: Structural Characterization of the Glycan Assemblies of O-linked Glycopeptides Using Cyclic Ion Mobility
2021|Waters|Applications
Application NoteComprehending COVID-19: StructuralCharacterization of the Glycan Assemblies ofO-linked Glycopeptides Using Cyclic IonMobilityLindsay MorrisonWaters Corporation, Georgetown University Medical Center, Lombardi Comprehensive CancerCenterFor research use only. Not for use indiagnostic procedures.Save 15% off on Columns, Consumables and Spare Parts on Waters.com....
Key words
cyclic, cyclicims, imsfurin, furinglycan, glycanlinked, linkedmobility, mobilitycleavage, cleavageglycosylation, glycosylationselect, selectseries, seriesspike, spikeglycopeptides, glycopeptidessite, siteefforts, effortstri
Recombinant SARS-CoV-2 Receptor Binding Domain: Comprehensive Top-Down Sequence Confirmation, Curation and O-Glycosylation Site Determination
2021|Bruker|Applications
Recombinant SARS-CoV-2 Receptor Binding Domain:Comprehensive Top-Down Sequence Confirmation,Curation and O-Glycosylation Site DeterminationKnow your SARS-CoV-2 antigen structure before it´s use in research and diagnosticsAbstractThe COVID pandemic dramatically influences our life andthe demand remains very highfor recombinant SARS-CoV-2surface proteins for diagnostics,vaccinedevelopmentandresearch. The...
Key words
maldi, maldirbd, rbdisd, isdglycosylation, glycosylationbruker, brukerrbds, rbdsterminal, terminalsialexo, sialexosequence, sequencedown, downspectra, spectrapngase, pngasecho, chocompass, compasstop
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE000055A quick and robust mass spectrometry-basedmethod for the detection of SARS-CoV-2Authors: Richard J. Gibson1, Stephanie N.Samra1, Kerry M. Hassell1, George A.Renney2, Bradley J. Hart11Thermo Fisher Scientific, San Jose, CA, US2Thermo Fisher Scientific, HemelHempstead, United KingdomKeywords: TSQ Altis MD MS,...
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fischer Scientific|Applications
TECHNICAL NOTE65974LC-MS for detection of SARS-CoV-2viral and host proteinsAuthors: Kruthi Suvarna1,Medha Gayathri J Pai1, Sanjeeva Srivastava1,Debadeep Bhattacharyya2, Kerry Hassell2Indian Institute of Technology, Bombay,Powai, Mumbai, India2Thermo Fisher Scientific,San Jose, CA, USA1Keywords: COVID-19, SARS-CoV-2,host response, nasopharyngeal, plasma,mass spectrometry, omics, TSQ Altis,Orbitrap Fusion...
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkcovid, covidaltis