Using Agilent Certified Pre-Owned Instruments to Research the Prediction of Covid-19

Others | 2021 | Agilent TechnologiesInstrumentation
GC/MSD, LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Agilent Technologies

Summary

Significance of the topic


Early warning of viral outbreaks is critical for timely public health interventions. Wastewater-based epidemiology offers a scalable, non-invasive approach to monitor SARS-CoV-2 transmission at the community level by detecting viral components shed in sewage.

Study objectives and overview


This case study from Ontario Tech University aimed to evaluate whether measuring SARS-CoV-2–related proteins in wastewater could reliably predict increases in COVID-19 cases before clinical confirmation, complementing existing RNA-based surveillance methods.

Methodology


Researchers collected raw sewage samples from five wastewater treatment facilities in the Durham Region of Ontario (Ajax, Clarington, Pickering, Oshawa, Whitby). Solid matter was concentrated by chemical precipitation and centrifugation to produce a pellet that was enzymatically digested into peptide fragments. These peptides were then analyzed by high-resolution mass spectrometry to identify and quantify proteins associated with SARS-CoV-2 and host response markers.

Instrumentation used


  • Agilent 6530 LC/Q-TOF MS (certified pre-owned) for proteomic analysis
  • Agilent certified pre-owned GC/MS for complementary studies
  • Planned acquisition of an Agilent LC/QQQ MS for targeted quantitative assays

Main results and discussion


Analysis revealed a pronounced increase in SARS-CoV-2–associated peptides in wastewater approximately ten days prior to a corresponding rise in clinically confirmed cases. In addition to viral proteins, certain human proteins showed elevated levels, suggesting potential host-response biomarkers. This proteomics-based approach may enhance sensitivity and stability compared to RNA measurements alone.

Contributions and practical applications


  • Demonstrated feasibility of protein-level detection of SARS-CoV-2 in wastewater as an early surveillance tool.
  • Showcased cost-effective implementation using certified pre-owned analytical instruments without compromising data quality.
  • Provided a framework for public health agencies to allocate resources and implement containment measures proactively.

Future trends and potential applications


  • Standardization of wastewater proteomic protocols for routine epidemiological monitoring.
  • Expansion to multiplexed detection of diverse pathogens and emerging biomarkers.
  • Integration with machine-learning models for real-time outbreak prediction and decision support.

Conclusion


Proteomic wastewater surveillance using high-resolution mass spectrometry offers a promising early-warning system for COVID-19 and other infectious diseases. Leveraging certified pre-owned instruments can enhance accessibility and sustainability of large-scale monitoring programs.

References


No formal references were provided in the original case study.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
To gain new biological insights - Virus research solutions
To gain new biological insights - Virus research solutions
2022|Thermo Fisher Scientific|Brochures and specifications
Go beyond To gain new biological insights Virus research solutions An urgent need for expanded virus research Harness the power of omics to accelerate virus research. Thermo Fisher Scientific’s proteomics, glycomics, lipidomics and metabolomics mass spectrometry workflows provide virus researchers…
Key words
thermo, thermovirus, virusscientific, scientificviral, viralneo, neosoftware, softwarevanquish, vanquishuhplc, uhplcdiscoverer, discovererinsights, insightsorbitrap, orbitrapproteome, proteometmt, tmtprotein, proteineasypep
An urgent need for expanded virus research
An urgent need for expanded virus research
2020|Thermo Fisher Scientific|Technical notes
WHITE PAPER 65880 An urgent need for expanded virus research The role of mass spectrometry in understanding virus structure and function If we needed any additional evidence that virus research is an important area to emphasize, the severe acute respiratory…
Key words
virus, virusviral, viralprotein, proteinhost, hostimmune, immuneinteractions, interactionsproteins, proteinsmhc, mhchdx, hdxglycosylation, glycosylationpeptides, peptidesvaccine, vaccinestructural, structuralmembrane, membranecell
Development of an Assay for the COVID-19 Drug Remdesivir- Toward Proper Remdesivir Use in Patients with Pre-Existing Conditions
Application Note No. 76 Development of an Assay for the COVID-19 Drug Remdesivir- Toward Proper Remdesivir Use in Patients with Pre-Existing Conditions‐ Atsushi Yonezawa 1, Eishi Imoto2, Yoshihiro Hayakawa2 Pharmaceutical Pharmaceuticals  Abstract This article establishes a mass spectrometer-based analytical…
Key words
remdesivir, remdesivirpatients, patientsrenal, renaldysfunction, dysfunctionkyoto, kyotonucleoside, nucleosideother, otherapproval, approvalclinical, clinicalgranted, grantedimpaired, impairedhospital, hospitalpharmaceuticals, pharmaceuticalsdrug, drugtrials
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptidetime, timeratio, ratioarea, areamin, minpeptides
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike