To gain new biological insights - Virus research solutions
Brochures and specifications | 2022 | Thermo Fisher ScientificInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap, LC/QQQ
IndustriesPharma & Biopharma, Proteomics , Metabolomics
ManufacturerThermo Fisher Scientific
Key wordsthermo, virus, scientific, viral, neo, software, insights, vanquish, uhplc, discoverer, proteome, orbitrap, tmt, protein, easypep, proteins, peptides, mass, targeted, pierce, analyzed, system, kit, digested, powerful, tribrid, spectrometer, surequant, research, metabolomics, derived, heavypeptide, pepmap, eclipse, prep, quantitation, integrative, extracted, biological, understanding, crosslinking, phosphopeptides, spectrometry, structural, msⁿ, infection, hram, skyline, aqua, node
Similar PDF
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Key words
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggdgiiwvategalntpk, dgiiwvategalntpksrm, srmpeptides, peptidesarea
An urgent need for expanded virus research
2020|Thermo Fisher Scientific|Technical notes
WHITE PAPER 65880 An urgent need for expanded virus research The role of mass spectrometry in understanding virus structure and function If we needed any additional evidence that virus research is an important area to emphasize, the severe acute respiratory…
Key words
virus, virusviral, viralprotein, proteinhost, hostimmune, immuneinteractions, interactionsproteins, proteinsmhc, mhchdx, hdxglycosylation, glycosylationvaccine, vaccinepeptides, peptidesstructural, structuralmembrane, membranecell
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Applications
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Key words
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrdgiiwvategalntpk, dgiiwvategalntpknpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
Integration of MSstatsTMT into Proteome Discoverer Using the Scripting Node
2020|Thermo Fisher Scientific|Posters
Integration of MSstatsTMT into Proteome Discoverer Using the Scripting Node David M. Horn, 1 Ting Huang, 2 Meena Choi, 2 Olga Vitek, 2 Rosa I. Viner, 1 Frank Berg3, Kai Fritzemeier,3 and Carmen Paschke3 1Thermo Fisher Scientific, San Jose, CA,…
Key words
msstatstmt, msstatstmtdatasets, datasetsdiscoverer, discovererproteome, proteomescripting, scriptingnode, nodeadeptly, adeptlyapoptotic, apoptoticparental, parentalamino, aminointegration, integrationproteins, proteinsparticipate, participatebiosynthetic, biosyntheticabundance