Characterization of the Anticoagulant Nadroparin by 2D-LC With High‑Resolution MS

Applications | 2022 | Agilent TechnologiesInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, 2D-LC
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the Topic


The structural complexity of low molecular weight heparins demands advanced analytical methods to guarantee drug safety by detecting impurities and verifying batch consistency.

Objectives and Study Overview


To establish a two-dimensional liquid chromatography method coupled with high-resolution mass spectrometry for comprehensive profiling of the anticoagulant nadroparin, enabling resolution of oligosaccharide chain lengths and compositions.

Methodology and Instrumentation


A two-dimensional workflow was developed combining:
  • First dimension: Size exclusion chromatography to separate degrees of polymerization (DP6–DP16).
  • Second dimension: Ion-pair reversed-phase chromatography using pentylamine and hexafluoroisopropanol buffers to resolve isomeric oligosaccharide compositions.
  • Detection: Agilent 6546 LC/Q-TOF with dual Jet Stream ESI for high-resolution mass analysis.

Instrument control and data processing were performed using Agilent MassHunter software suite.

Main Results and Discussion


High retention time precision (<0.1% RSD) permitted reliable time-based heart-cutting into the second dimension.
Twenty-eight distinct nadroparin compositions across DP6 to DP16 were identified, revealing diverse sulfation patterns.
Pentylamine adduct formation enhanced negative ion detection and preserved sulfated structures in the MS spectra.
The method demonstrated the ability to resolve multiple isobaric and isomeric oligosaccharides within the same chain length.

Benefits and Practical Applications


  • Robust quality control assay for commercial and generic heparins.
  • Automated desalting step reduces sample preparation and instrument contamination.
  • Detailed top-down characterization supports biosimilar equivalence studies.
  • Enhanced safety monitoring by detecting known and unknown heparin contaminants.

Future Trends and Potential Applications


Advances in stationary phases and multidimensional separation techniques will further improve resolution of complex glycans.
Integration with machine learning algorithms may accelerate data interpretation and pattern recognition in polysaccharide analysis.
The workflow could be extended to other biopharmaceuticals, such as glycoproteins and complex oligosaccharides.

Conclusion


The developed 2D-LC/HRMS platform provides a powerful, high-resolution approach to dissect the structural heterogeneity of nadroparin, ensuring product quality and safety through detailed molecular profiling.

Used Instrumentation


  • Agilent 1290 Infinity II Bio two-dimensional LC system
  • Agilent 6546 LC/Q-TOF mass spectrometer
  • Agilent MassHunter Acquisition and Qualitative Analysis software

References


  1. Gray E Mulloy B Barrowcliffe TW. Heparin and Low-Molecular-Weight Heparin. Thromb Haemost. 2008;99(5):807–818.
  2. Mousa SA. Are Low Molecular Weight Heparins the Same? Methods Mol Med. 2004;93:Anticoagulants, Antiplatelets, and Thrombolytics.
  3. Liu H Zhang Z Linhardt RJ. Lessons Learned from the Contamination of Heparin. Nat Prod Rep. 2009;26(3):313–321.
  4. Wang Z Chi L. Recent Advances in Mass Spectrometry Analysis of Low Molecular Weight Heparins. Chinese Chem Lett. 2018;29:11–18.
  5. Ouyang Y et al. Profiling Analysis of Low Molecular Weight Heparins by Multiple Heart-Cutting Two Dimensional Chromatography with Q-TOF MS. Anal Chem. 2015;87:8957–8963.
  6. Agilent Technologies. 2D-LC as an Automated Desalting Tool for MSD Analysis. Application note. 2017.
  7. Doneanu CE Chen W Gebler JC. Analysis of Oligosaccharides Derived from Heparin by IP-RP Chromatography/MS. Anal Chem. 2009;81(9):3485–3499.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance
Determination of Multiple Attributes of Monoclonal Antibodies
Application Note Biopharma/Pharma Determination of Multiple Attributes of Monoclonal Antibodies Simultaneous and parallel multi-attribute analysis using 3D-LC/MS with 2D multimethod option mAb SEC Size variants Protein A CEX LC/MS mAb Titer Charge variants Mol wt (MW) AA sequence PTM Cell…
Key words
trastuzumab, trastuzumaboriginator, originatorcex, cexmau, mauhic, hiccho, chohmw, hmwprotein, proteinvariants, variantscounts, countsdeconvoluted, deconvolutedclone, cloneclones, clonesmin, minvalve
Optimizing HILIC-based Analyses of RapiFluor-MS Labeled  Sialylated N-Glycans
[ APPLICATION NOTE ] Optimizing HILIC-based Analyses of RapiFluor-MS Labeled Sialylated N-Glycans Qi Wang and Matthew A. Lauber Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ ■■ INTRODUCTION Tuned source parameters and acquisition settings to improve the intensity and…
Key words
rapifluor, rapifluorsialylated, sialylatedglycans, glycansglycan, glycanhilic, hiliclabeled, labeledsialic, sialicamide, amideglycoprotein, glycoproteinacquity, acquityoptimizing, optimizinguplc, uplcneuraminidase, neuraminidaselinkage, linkagebeh
Application Solutions for Biopharmaceuticals - A Focus on Protein Therapeutics
ApplicAtion SolutionS for BiophArmAceuticAlS A Focus on Protein Therapeutics Introduction: Key Challenges in Biopharmaceutical Characterization .............................................................................................5 7 PROTEIN mass aNalysIs comprehensive and routine characterization of proteins and peptides by lc/mS and lc/mS e ...............................................................9 characterization of an igG1 monoclonal Antibody…
Key words
uplc, uplcpeptide, peptideprotein, proteinwaters, watersacquity, acquityglycan, glycanantibody, antibodymass, massglycans, glycanspeptides, peptidessystem, systemanalysis, analysismapping, mappingintact, intactbiopharmalynx
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike