Analysis of Adeno-Associated Virus Quality Attributes with LC-FLD-(MS)
Posters | 2022 | Agilent Technologies | ASMSInstrumentation
HPLC, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Key wordscapsid, full, empty, expected, relative, enlarged, height, observed, adeno, aav, protein, aggregation, capsids, stoichiometry, monomeric, thyroglobulin, fluorescence, virus, reproducibility, ratios, intrinsic, fld, diphenyl, associated, thryroglobulin, ylgpfngldkgepvneadaaalehdktydr, attributes, analysis, poster, tetramethylammonium, quality, serotype, aavs, accounting, area, globulin, aggregated, homologous, vectors, discussion, ovalbumin, vehicles, stranded, conform, viral, cqas, stressed, myoglobin, hydrodynamic, radius
Similar PDF
LC/MS of Intact Adeno-Associated Virus Capsid Proteins for Rapid Confirmation of Product Identity
2021|Agilent Technologies|Applications
Application Note LC/MS of Intact Adeno-Associated Virus Capsid Proteins for Rapid Confirmation of Product Identity Author Brian Liau Agilent Technologies, Inc. Introduction Adeno-associated viruses (AAVs) are a promising new class of biotherapeutic capable of treating a host of rare and…
Key words
amu, amudeconvoluted, deconvolutedcapsid, capsidaav, aavmass, massrresponse, rresponseadeno, adenocounts, countsvirus, virusacquisition, acquisitionfld, fldassociated, associatedprotein, proteintime, timemin
Developing the analytics and analytical workflows supporting the analysis of the next generation of biotherapeutic and gene therapies
2020|Waters|Presentations
Developing the analytics and analytical workflows supporting the analysis of the next generation of biotherapeutic and gene therapies. Scott J. Berger, Ph.D. and Ximo Zhang, Ph.D. Waters Lunch Seminar Tuesday January 28, 2020 WCBP 2020 Diamond Program Partner ©2020 Waters…
Key words
capsid, capsidaav, aavempty, emptydevelopment, developmentgene, geneprotein, proteincapsids, capsidstherapy, therapysec, secfull, fullproteins, proteinsmonitoring, monitoringiex, iexrplc, rplcmeasure
Characterization of Adeno-Associated Viral assemblies on an Ultra-High Mass Range Hybrid Quadrupole-Orbitrap Mass Spectrometer
2021|Thermo Fisher Scientific|Posters
Characterization of Adeno-Associated Viral assemblies on an Ultra-High Mass Range Hybrid QuadrupoleOrbitrap Mass Spectrometer Kristina Srzentić1, Eugen Damoc2, Marc Günder1 1Thermo Fisher Scientific, Reinach, Switzerland 2Thermo Fisher Scientific, Bremen, Germany ABSTRACT Purpose: Evaluate the performance of the Thermo Scientific™ Q…
Key words
viral, viralaav, aavintact, intactmass, massanalysis, analysisadeno, adenoassemblies, assembliesdenaturing, denaturingunder, underassociated, associatedstoichiometries, stoichiometriesnative, nativeassembly, assemblyvanquish, vanquishnear
Optimizing Adeno-Associated Virus (AAV) Capsid Protein Analysis Using UPLC and UPLC-MS
2020|Waters|Applications
[ APPLICATION NOTE ] Optimizing Adeno-Associated Virus (AAV) Capsid Protein Analysis Using UPLC and UPLC-MS Ximo Zhang, Stephan Koza, Ying Qing Yu, and Weibin Chen Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■ ■ INTRODUCTION An optimized LC-MS solution for…
Key words
capsid, capsidaav, aavadeno, adenouplc, uplcvirus, virusassociated, associatedproteins, proteinsoptimizing, optimizingmass, massraav, raavflr, flrtherapy, therapygene, geneacquity, acquityprotein