Optimization of FAIMS-XL-MS Workflow for Phospho-Enrichable Crosslinkers
Posters | 2022 | Thermo Fisher Scientific | ASMSInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Key wordsfaims, phox, dspp, dsso, magnetic, agarose, identified, nta, beads, phospho, enrichable, enrich, crosslinkers, crosslinker, crosslinked, protein, arb, gas, ids, pierce, charge, enriched, hcd, resolution, voltage, sweep, csms, phosphor, unenriched, total, cleavable, spray, cross, peptides, flow, state, bca, sequest, collision, ion, energy, workflow, unmodified, immobilized, min, using, standard, linking, funnel, value
Similar PDF
Optimized Sample Preparation for Phospho-Enrichable Crosslinkers
2022|Thermo Fisher Scientific|Posters
Optimized Sample Preparation for Phospho-Enrichable Crosslinkers LEIGH FOSTER1; Amarjeet Flora1; Premchendar Nandhikonda1; Rosa Viner2; Chris Etienne1; Ryan Bomgarden1 1Thermo Fisher Scientific, Rockford, IL; 2Thermo Fisher Scientific, San Jose, CA Purpose: To optimize DSPP and TBDSPP crosslinking conditions, phosphatase treatment, protein…
Key words
dspp, dspptbdspp, tbdsppcrosslinks, crosslinksunenrich, unenrichcrosslinked, crosslinkedcrosslinking, crosslinkingeasypep, easypepcrosslink, crosslinkenriched, enrichedhela, helapac, pacidentifications, identificationsbsa, bsanumber, numbernta
New tools for improved proteomics results
2022|Thermo Fisher Scientific|Brochures and specifications
Proteomics New tools for improved proteomics results Sample preparation, quantitation, and instrument calibration reagents for proteomic mass spectrometry Introduction We offer a complete portfolio of sample preparation, protein quantitation, and instrument calibration solutions and standards designed for better mass spectrometry…
Key words
surequant, surequanteasypep, easypepprotein, proteinpierce, piercephosphopeptide, phosphopeptidetmtpro, tmtprotbdspp, tbdsppakt, aktpeptide, peptidekit, kitthermo, thermodisuccinimidyl, disuccinimidylscientific, scientificdspp, dspppeptides
Evaluation of FAIMS Technology for Mass Spec Analysis of Chemical Cross-linked Peptides
2019|Thermo Fisher Scientific|Posters
Evaluation of FAIMS Technology for Mass Spec Analysis of Chemical Cross-linked Peptides Rosa Viner1; Leigh A Foster2; Ryan D. Bomgarden2; Michael W. Belford1; Satendra Prasad1; Romain Huguet1; Eloy R. Wouters1 , 1Thermo Fisher Scientific, San Jose, CA; 2Rockford, IL ABSTRACT…
Key words
faims, faimsscx, scxpeptides, peptidescrosslinked, crosslinkeddss, dsscross, crossfractionation, fractionationlinked, linkedmass, massnce, ncemax, maxunmodified, unmodifiedpierce, piercesettings, settingshcd
Notch3 Epitope Mapping using Integrated Structural Proteomic Techniques
2021|Thermo Fisher Scientific|Posters
Notch3 Epitope Mapping using Integrated Structural Proteomic Techniques Terry Zhang1, Leigh Foster2, Ryan Bomgarden2, Veronica Saenz-Vash3, Huili Zhai3, Rosa Viner1, 1Thermo Fisher Scientific, San Jose, CA;2 Rockford, IL, 3Novartis Research Institute, Cambridge, MA ABSTRACT RESULTS Purpose: Perform epitope mapping in…
Key words
hdx, hdxepitope, epitopedhso, dhsoparatope, paratopedspp, dsppepitopes, epitopessda, sdaleap, leapnative, nativecrosslinked, crosslinkedallargvlvltvllppeellrssadflqrlsailrtslrfrldahgq, allargvlvltvllppeellrssadflqrlsailrtslrfrldahgqamvfpyhrpspgseprasselapevigsvvmleidnrlclqspen, amvfpyhrpspgseprasselapevigsvvmleidnrlclqspenapevseeprcpraacqakrgdqrcdrecnspgcgwdggdcsl, apevseeprcpraacqakrgdqrcdrecnspgcgwdggdcsldhcfpdaqsaadylgalsaverldfpyplrdvrgepleppepsgs, dhcfpdaqsaadylgalsaverldfpyplrdvrgepleppepsgshhhhhh