LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Meat authentication and adulteration testing by HPLC combined with high-resolution, accurate-mass (HRAM) mass spectrometry

 

Similar PDF

Toggle
Complete method: Alberto Ruiz Orduna, Erik Husby, Charles T. Yang, Dipankar Ghosh & Francis Beaudry (2015): Assessment of meat authenticity using bioinformatics, targeted peptide biomarkers and high-resolution mass spectrometry, Food Additives & Contaminants: Part A, DOI: 10.1080/19440049.2015.1064173 Ap plica t…
Key words
lamb, lambpork, porkmeat, meatbeef, beefhorse, horsehaemoglobin, haemoglobinproteotypic, proteotypichpgdfgadaqgamtk, hpgdfgadaqgamtkhpsdfgadaqgamsk, hpsdfgadaqgamskhpgdfgadaqgamsk, hpgdfgadaqgamskhpsdfgadaqaamsk, hpsdfgadaqaamskmyoglobin, myoglobinspecies, speciesauthenticity, authenticitytryptic
PO-CON1536E Cooked meat product analysis by LCMS/MS to determine between animal species using proteotypic peptide quantitative proteomic analysis ASMS 2015 WP 099 Alan J. Barnes1, Neil J. Loftus1, Junko Iida2 1 Shimadzu, Manchester, UK Shimadzu, Kyoto, Japan. 2 Cooked meat…
Key words
cooked, cookedproteotypic, proteotypichorse, horseanimal, animalmeat, meatproteomic, proteomicbeef, beefspecies, speciespeptide, peptidefood, foodlcms, lcmshaché, hachémyosin, myosincollagen, collagensausage
vMethod™ Application for Food Testing Screening and Speciation of Raw and Processed Meat Products A Selective and Robust LC-MS/MS Method for Multiple Meat Speciation and Authentication on the QTRAP® 4500 System Rapid and Reliable Detection of Multiple Meat Species in…
Key words
meat, meatsausage, sausagehalal, halalpeptide, peptidespecies, speciespeptides, peptidesbeef, beefspeciation, speciationunique, uniquesignature, signaturelamb, lambfood, foodcooked, cookedprotein, proteinwere
Application News AD-0153 Halal Authentication Analysis / LCMS-8060 Highly-Sensitive Detection of Multiple Porcine-Specific Peptides in Processed Foods by LC/MS/MS Method Udi Jumhawan, Jie Xing & Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific) Pte Ltd, Singapore  Introduction…
Key words
lvvi, lvvipork, porkydii, ydiiporcine, porcinesala, salapeptide, peptidehalal, halalmarkers, markersfvie, fviespecific, specificpeptides, peptidesevte, evtetlaf, tlaftvlg, tvlgprocessed
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike