Quantitative analysis of signaling pathways using TMT 11plex reagents and comprehensive phosphopeptide enrichment strategies
Posters | 2017 | Thermo Fisher Scientific | HUPOInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesProteomics
ManufacturerThermo Fisher Scientific
Key wordssignaling, smoac, phosphopeptides, tpa, peptides, peptide, nta, condition, treatment, blot, egf, enrichment, verified, phosphopeptide, lysate, pool, cell, area, western, hela, receptor, mass, proteome, fenta, foxo, hippo, miedair, neurotrophin, pgdf, rqr, serumstarved, shsesaspsalssspnnlsptgwsq, stim, ststpnvhmvsttlpvdsr, spec, gnrh, erbb, nocodazole, pdgf, mapk, phosphoenrichment, number, specificity, ampk, pkg, thermo, target, fbs, noc, assess
Similar PDF
Sequential enrichment using metal oxide affinity chromatography (SMOAC) to enhance phosphoproteome coverage for quantitative proteomic analysis
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 65381 Sequential enrichment using metal oxide affinity chromatography (SMOAC) to enhance phosphoproteome coverage for quantitative proteomic analysis Authors Jae Choi, Ryan Bomgarden, Bhavin Patel, Leigh Foster, Sergei Snovida, John C. Rogers Thermo Fisher Scientific, Rockford, IL, USA Introduction…
Key words
smoac, smoacphosphopeptides, phosphopeptidesphosphopeptide, phosphopeptideenrichment, enrichmentnta, ntasimac, simacfractionation, fractionationphosphorylation, phosphorylationphosphoproteome, phosphoproteomesequential, sequentialpierce, piercefbs, fbstmt, tmtthermo, thermoscientific
Quantitative, comprehensive multi-pathway signaling analysis using an optimized phosphopeptide enrichment method combined with an internal standard triggered targeted MS assay
2019|Thermo Fisher Scientific|Posters
Quantitative, comprehensive multi-pathway signaling analysis using an optimized phosphopeptide enrichment method combined with an internal standard triggered targeted MS assay Bhavin Patel1; Penny Jensen1; Aaron S. Gajadhar2; Sebastien Gallien3; Jae Choi1; Romain Huguet2; Graeme McAlister2; Derek Bailey2; Shannon Eliuk2; Markus…
Key words
phosphopeptide, phosphopeptidesurequant, surequanthela, helasignaling, signalingphosphopeptides, phosphopeptideshegf, hegfsmoac, smoacegf, egfheavy, heavysmaoc, smaocenrichment, enrichmenthiselecttm, hiselecttmenriched, enrichedpeptides, peptidespathway
Quantitative, comprehensive multi-pathway signaling analysis using an optimized phosphopeptide enrichment method combined with an internal standard triggered targeted MS assay
2019|Thermo Fisher Scientific|Posters
Quantitative, comprehensive multi-pathway signaling analysis using an optimized phosphopeptide enrichment method combined with an internal standard triggered targeted MS assay Bhavin Patel1; Penny Jensen1; Aaron S. Gajadhar2; Sebastien Gallien3; Jae Choi1; Romain Huguet2; Graeme McAlister2; Derek Bailey2; Shannon Eliuk2; Markus…
Key words
phosphopeptide, phosphopeptidesignaling, signalingsurequant, surequanthela, helaphosphopeptides, phosphopeptideshegf, hegfsmoac, smoacegf, egfpathway, pathwayenrichment, enrichmentheavy, heavysmaoc, smaocpeptides, peptideshiselecttm, hiselecttmenriched
Sequential enrichment from Metal Oxide Affinity Chromatography (SMOAC), a phosphoproteomics strategy for the separation of multiply phosphorylated from monophosphorylated peptides.
2017|Thermo Fisher Scientific|Posters
Sequential enrichment from Metal Oxide Affinity Chromatography (SMOAC), a phosphoproteomics strategy for the separation of multiply phosphorylated from monophosphorylated peptides. Jae Choi, Sergei I. Snovida, Ryan Bomgarden, John C. Rogers, Thermo Fisher Scientific, Rockford, IL, 61101, USA Purpose: We explored…
Key words
smoac, smoacphos, phosnta, ntasimac, simacfractionation, fractionationslchdeienlldsdhr, slchdeienlldsdhrphosphorylated, phosphorylatedmultiply, multiplyphosphopeptides, phosphopeptideseegssgsgpsfr, eegssgsgpsfrlfdspslcssstr, lfdspslcssstrmgssestdsgfcldspgpldsk, mgssestdsgfcldspgpldsktvslcdititqmleedsnqghligdfsk, tvslcdititqmleedsnqghligdfskpeptides, peptideswash