Efficient Purification of Synthetic Peptides at High and Low pH

Applications | 2022 | Agilent TechnologiesInstrumentation
HPLC
Industries
Pharma & Biopharma
Manufacturer
Agilent Technologies

Summary

Significance of the Topic


Synthetic peptides are a growing class of therapeutic agents, but their purification often encounters challenges related to solubility and the amphoteric nature of amino acids. Achieving high purity under both acidic and basic conditions is critical for downstream bioactivity testing, safety assessment, and regulatory compliance.

Objectives and Study Overview


This application note describes a unified workflow for developing analytical HPLC methods and scaling them to preparative purification on a single instrument. The approach leverages valve automation to switch seamlessly between low-pH and high-pH separations, enabling effective isolation of crude synthetic peptides, exemplified by angiotensin I.

Methodology and Instrumentation


The entire workflow was carried out on an Agilent 1290 Infinity II Autoscale Preparative LC/MSD system equipped with quaternary and binary pumps, UV and diode array detectors, MS flow modulator, and preparative fraction collector. Analytical tests employed Agilent InfinityLab Poroshell 120 SB-C18 and HPH-C18 columns (4.6×150 mm, 4 µm), while preparative runs used 21.2×150 mm, 4 µm columns of the same stationary phases. Mobile phases were:
  • Low pH: 0.1% trifluoroacetic acid in water (A) and acetonitrile (B).
  • High pH: 10 mM ammonium bicarbonate, pH 9.8 in water (A) and ACN:water 90:10 (B).
Gradient, flow rates (1.5 mL/min analytical, 32 mL/min preparative), detection at 220 nm, and MSD settings were optimized and kept consistent across pH modes. Automated valves enabled rapid switching of solvents and columns by method parameters.

Key Results and Discussion


Generic gradients (9–99% B) were first applied to diluted angiotensin I samples at both pH values. Retention data guided the design of focused shallow gradients, which significantly improved resolution between the target peptide and major impurities. The optimized analytical methods were transferred to preparative scale using Agilent’s gradient translation tool, with sample loads increased 200-fold (20–30 mg).

Preparative chromatograms revealed sharp separation of angiotensin I under both pH regimes. Fraction collection was triggered on combined UV and MS signals, with time slices of 6 s each. Reanalysis of collected fractions demonstrated that, except for the first and last slices, all fractions exceeded 95% purity by UV detection. A minor coeluting impurity, likely a deletion variant of angiotensin I, was detected only during fraction reanalysis, illustrating the value of slice collection and automated purity assessment.

Benefits and Practical Applications


  • Single-system workflow eliminates instrument swaps and manual reconfiguration.
  • Automated valve switching enables rapid transitions between pH modes and scales.
  • Focused gradients based on analytical retention times maximize resolution and loading capacity.
  • Time-slice fractionation combined with MS ensures collection of only high-purity product, reducing waste and re-runs.

Future Trends and Applications


Integrating high-resolution mass spectrometers could elucidate coeluting impurities in real time. Further automation, such as AI-driven method development, and multi-dimensional chromatographic strategies will expand applicability to more complex peptides and peptide conjugates. Continuous flow purification and online quality control may further accelerate peptide biomanufacturing.

Conclusion


This work demonstrates efficient purification of a synthetic peptide under both acidic and basic conditions using a single HPLC-MS system. Automated switching of columns and mobile phases, coupled with focused gradients and fraction reanalysis, enabled isolation of angiotensin I at >95% purity in a streamlined workflow.

References


  1. Muttenthaler M. et al. Trends in Peptide Drug Discovery. Nat. Rev. Drug Discov. 2021;20:309–325.
  2. Penduff P. Analytical to Preparative HPLC Method Transfer. Agilent Technologies Technical Overview. 2013;5991-2013EN.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Fast and Selective Purification of Oligonucleotides Using Preparative HPLC/MS and Software Support
Application Note Biopharma/Pharma Fast and Selective Purification of Oligonucleotides Using Preparative HPLC/MS and Software Support mAU UV 800 400 0 cps 80,000 2 4 6 8 10 12 min 2 4 6 8 10 12 min 2 4 6 8…
Key words
fraction, fractionpurification, purificationflp, flppreparative, preparativemsd, msdcollection, collectionmin, minhfip, hfipwere, weredba, dbacps, cpsmau, mautrigger, triggerruns, runsoligonucleotides
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance
Isolate and Reanalyze Pharma Impurities with the Agilent 1290 Infinity II Autoscale Preparative LC/MSD System
Application Note Pharmaceutical Small Molecules Isolate and Reanalyze Pharma Impurities with the Agilent 1290 Infinity II Autoscale Preparative LC/MSD System API Author Florian Rieck Agilent Technologies, Inc. Abstract Isolation of impurities for further characterization is a routine task in the…
Key words
preparative, preparativefraction, fractionmsd, msdreanalysis, reanalysisscale, scalefractions, fractionsmau, maureanalyzed, reanalyzedinjection, injectionimpurities, impuritiesanalytical, analyticalopen, openautoscale, autoscalesampler, samplercollector
Two-Dimensional Isolation of Target Compounds from Complex Natural Products with Agilent InfinityLab 2D‑LC Solutions
Application Note Pharma & Biopharma Two-Dimensional Isolation of Target Compounds from Complex Natural Products with Agilent InfinityLab 2D‑LC Solutions mAU 3,000 2,500 2,000 1,500 1,000 500 0 D 1 0 mAU 5 10 15 Time (min) 20 25 D 2…
Key words
salidroside, salidrosiderosavin, rosavinmau, maumin, minfraction, fractionisolation, isolationtarget, targetpurity, puritynatural, naturalfrom, fromrhodiola, rhodiolamsd, msdflow, flowtime, timepurification
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike