Optimizing Analysis and Purification of a Synthetic Peptide Using PLRP-S Columns
Applications | 2023 | Agilent TechnologiesInstrumentation
The development and purification of synthetic peptides play a critical role in modern biopharmaceutical research and production. Reliable and scalable methods for peptide analysis and isolation enable rapid development of peptide therapeutics, diagnostics, and vaccines. Optimized chromatographic processes reduce development times, increase product purity, and support efficient scale-up from analytical to preparative scales.
This study focuses on the analysis and scale-up purification of human glucagon-like peptide-1 (GLP-1) 7-36 amide, a 30 amino acid chain of 3,297.7 Da. Using reversed-phase ion-pair chromatography with trifluoroacetic acid in the mobile phase, the work demonstrates direct transfer of gradient and loading conditions from analytical PLRP-S columns (4.6×250 mm, 8 µm) to preparative PLRP-S columns (21.2×250 mm, 8 µm) with both 100 and 300 Å pore sizes.
Sample Preparation and Chromatography
Instrumentation
Initial crude purity differed by resin choice: peptide from PL-Rink resin showed higher crude purity (43 to 46 %) than AmphiSpheres resin (33 to 41 %). Both 100 and 300 Å pore sizes offered efficient separations, with the 100 Å column providing slightly higher purification capacity and the 300 Å column delivering sharper peaks for larger species. Preparative runs purified 1 mg of crude peptide per injection, yielding overall purities up to 98 % and recoveries above 90 % for the PL-Rink sample. LC/MS spectra confirmed the expected charge states of the full-length peptide and absence of major side products.
Direct scalability of analytical methods to preparative dimensions reduces method development time and cost. PLRP-S media provide robust hydrophobic separation without bonded alkyl chains, ensuring chemical and physical stability. Choice of pore size allows tuning of loading capacity and mass transfer, supporting efficient purification of a wide range of peptide sizes.
Advances may include novel stationary phase chemistries for enhanced selectivity, greener ion-pair reagents to improve MS compatibility, and integration of continuous-flow preparative systems. Automation and real-time analytics can further accelerate peptide process development and scale-up.
This work highlights the versatility and scalability of Agilent PLRP-S columns for synthetic peptide purification. Consistent method transfer from analytical to preparative scale simplifies development workflows, and choice of pore size optimizes capacity and resolution. Coupling with advanced LC/MS detection ensures reliable identity confirmation of target peptides.
Tripodi A A P and Coffey A Optimizing Analysis and Purification of a Synthetic Peptide Using PLRP-S Columns Agilent Technologies Application Note May 2023
Consumables, HPLC, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, LC columns, PrepLC
IndustriesPharma & Biopharma
ManufacturerAgilent Technologies
Summary
Importance of Topic
The development and purification of synthetic peptides play a critical role in modern biopharmaceutical research and production. Reliable and scalable methods for peptide analysis and isolation enable rapid development of peptide therapeutics, diagnostics, and vaccines. Optimized chromatographic processes reduce development times, increase product purity, and support efficient scale-up from analytical to preparative scales.
Aims and Overview
This study focuses on the analysis and scale-up purification of human glucagon-like peptide-1 (GLP-1) 7-36 amide, a 30 amino acid chain of 3,297.7 Da. Using reversed-phase ion-pair chromatography with trifluoroacetic acid in the mobile phase, the work demonstrates direct transfer of gradient and loading conditions from analytical PLRP-S columns (4.6×250 mm, 8 µm) to preparative PLRP-S columns (21.2×250 mm, 8 µm) with both 100 and 300 Å pore sizes.
Methodology and Instrumentation
Sample Preparation and Chromatography
- Synthesis of GLP-1 7-36 amide on two solid supports: AmphiSpheres 40 RAM and PL-Rink resin using Fmoc chemistry.
- Analytical screening of gradients to identify optimal elution (35 to 50 %B) on PLRP-S columns.
- Scale-up by maintaining identical stationary phase material and gradient profiles.
Instrumentation
- Analytical HPLC: Agilent 1290 Infinity II system with high-speed pump, multisampler, multicolumn thermostat, and diode array detector.
- Preparative HPLC: Agilent 1290 Infinity II preparative binary pump, fraction collector, column compartment, and diode array detector.
- LC/MS: Agilent 1290 Infinity II coupled to 6545XT AdvanceBio LC/Q-TOF and AdvanceBio Peptide Mapping column for final identity confirmation.
Main Results and Discussion
Initial crude purity differed by resin choice: peptide from PL-Rink resin showed higher crude purity (43 to 46 %) than AmphiSpheres resin (33 to 41 %). Both 100 and 300 Å pore sizes offered efficient separations, with the 100 Å column providing slightly higher purification capacity and the 300 Å column delivering sharper peaks for larger species. Preparative runs purified 1 mg of crude peptide per injection, yielding overall purities up to 98 % and recoveries above 90 % for the PL-Rink sample. LC/MS spectra confirmed the expected charge states of the full-length peptide and absence of major side products.
Benefits and Practical Applications
Direct scalability of analytical methods to preparative dimensions reduces method development time and cost. PLRP-S media provide robust hydrophobic separation without bonded alkyl chains, ensuring chemical and physical stability. Choice of pore size allows tuning of loading capacity and mass transfer, supporting efficient purification of a wide range of peptide sizes.
Future Trends and Potential Applications
Advances may include novel stationary phase chemistries for enhanced selectivity, greener ion-pair reagents to improve MS compatibility, and integration of continuous-flow preparative systems. Automation and real-time analytics can further accelerate peptide process development and scale-up.
Conclusion
This work highlights the versatility and scalability of Agilent PLRP-S columns for synthetic peptide purification. Consistent method transfer from analytical to preparative scale simplifies development workflows, and choice of pore size optimizes capacity and resolution. Coupling with advanced LC/MS detection ensures reliable identity confirmation of target peptides.
Reference
Tripodi A A P and Coffey A Optimizing Analysis and Purification of a Synthetic Peptide Using PLRP-S Columns Agilent Technologies Application Note May 2023
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Analysis and Purification of Synthetic Peptides by Liquid Chromatography
2023|Agilent Technologies|Brochures and specifications
Analysis and Purification of Synthetic Peptides by Liquid Chromatography Consumables workflow ordering guide 2 Synthetic Peptide Therapeutics Synthetic peptide therapeutics have become increasingly important in drug development research because of their increased efficacy, specificity, and lower toxicity. Peptides play a…
Key words
peptide, peptideadvancebio, advancebiocounts, countsresponse, responsetqf, tqfyour, yourretention, retentionagilent, agilentpurification, purificationsynthetic, syntheticcolumns, columnsrelative, relativeinfinitylab, infinitylabplrp, plrpservices
Agilent BioHPLC Columns - Characterization of NIST Monoclonal Antibody Critical Quality Attributes - Application Compendium
2019|Agilent Technologies|Guides
Agilent BioHPLC Columns Characterization of NIST Monoclonal Antibody Critical Quality Attributes Application Compendium Contents Agilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted from NISTmAb RM 8671 batch. Quality control (QC) testing is performed using Agilent LC-MS system. QC batch release test…
Key words
mab, mabglycan, glycanadvancebio, advancebiocounts, countspeptide, peptidemapping, mappingagilent, agilentmonoclonal, monoclonalglycans, glycansmin, mincolumn, columnmass, massprotein, proteinnistmab, nistmabassaymap
Intact & Subunit Analysis Using Reversed Phase - Agilent BioHPLC Columns Application Compendium
2020|Agilent Technologies|Guides
Agilent-NISTmAb Intact & Subunit Analysis Using Reversed Phase Agilent BioHPLC Columns Application Compendium Contents Agilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted from NISTmAb RM 8671 batch. Quality control (QC) testing is performed using Agilent LC-MS system. QC batch release test…
Key words
counts, countsmab, mabherceptin, herceptinintact, intactpage, pagecontents, contentsbonds, bondsback, backdeglycosylated, deglycosylatedmass, massdeconvoluted, deconvolutedides, idesamu, amubravo, bravoassaymap