Monoclonal Antibody (mAb) Intact Mass and Subunit Analysis Using Shimadzu Q-TOF LCMS-9030

Applications | 2023 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Significance of the Topic


Monoclonal antibodies serve as critical therapeutics in areas such as oncology and autoimmune diseases. Accurate molecular characterization of these large heterogeneous proteins underpins assessment of critical quality attributes in drug development and regulatory approval. Liquid chromatography coupled with mass spectrometry provides a powerful platform for both intact mass and subunit profiling of antibodies, revealing detailed information on glycosylation, disulfide linkage and oxidative modifications.

Objectives and Study Overview


This application note demonstrates a rapid and streamlined workflow for intact mass and subunit analysis of a humanized IgG1k reference material using the Shimadzu Q-TOF LCMS-9030. The goals are to validate mass accuracy against theoretical values, resolve glycoform distributions and illustrate a practical workflow for routine biopharma quality control.

Methodology


Sample Preparation
  • Intact mass: Dilution of reference antibody to 0.1 mg/mL in 0.1% formic acid
  • Subunit analysis: Denaturation and reduction with TCEP at 95 °C, enzymatic deglycosylation with PNGase F at 50 °C, final dilution to 0.1 mg/mL
Chromatographic Conditions
  • Column: Shim pack Scepter C4 2.1 × 150 mm, 1.9 µm
  • Mobile phases: 0.1% formic acid in water and acetonitrile
  • Flow rate: 0.3 mL/min, gradient elution over 18 min, column temperature 80 °C
  • Injection volume: 5 µL
Mass Spectrometry Conditions
  • Instrument: Shimadzu LCMS-9030 Q-TOF with heated electrospray ionization at 4.5 kV
  • Interface temperatures: DL 200 °C, heat block 400 °C
  • Gas flows: nebulizing 3 L/min, heating 10 L/min, drying 10 L/min
  • Acquisition: positive MS mode, m/z 300–4500

Used Instrumentation


  • Shimadzu LCMS-9030 Q-TOF mass spectrometer
  • Shim pack Scepter C4-300 column
  • Shimadzu Torast-H Bio Vials
  • Protein Metrics data processing software

Main Results and Discussion


Total ion chromatograms confirmed robust separation for both intact and subunit preparations. Deconvolution by Protein Metrics software yielded measured intact masses within ±20 Da of theoretical values for major glycoforms. Subunit analysis resolved light and heavy chains with mass deviations under 8 Da, enabling clear identification of glycoforms and oxidative modifications. These results highlight high mass accuracy and resolution afforded by the LCMS-9030 platform.

Benefits and Practical Applications


  • Rapid turnaround for intact mass and subunit profiling supports process development and batch release testing
  • High resolution aids in detecting minor variants and post-translational modifications
  • Streamlined workflow reduces sample handling time and minimizes potential artifacts

Future Trends and Possibilities


Advances may include automated top-down fragmentation for sequence confirmation, integration with ion mobility for conformer analysis and adoption of AI-driven data interpretation to accelerate decision making. Expansion into high throughput screening and real-time monitoring could further enhance biopharmaceutical characterization.

Conclusion


The combined intact mass and subunit analysis on the Shimadzu LCMS-9030 Q-TOF, paired with Protein Metrics software, delivers accurate and efficient characterization of monoclonal antibodies, supporting critical quality assessment throughout drug development.

References

  1. Srzentic S et al Interlaboratory Study for Characterizing Monoclonal Antibodies by Top-Down and Middle-Down Mass Spectrometry Journal of the American Society for Mass Spectrometry 31(9) 1783–1802 2020
  2. Robotham AC Kelly JF LC-MS Characterization of Antibody-Based Therapeutics Elsevier 2020

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030
ThP 407 Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030 Shannie Tay 1, Max Kosok1, Yu Jie Lee2 (1) Shimadzu (Asia Pacific), Singapore (2) National University of Singapore, Singapore. 1. Introduction 3. Results Sample name ◆ Monoclonal antibody…
Key words
gfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskgfypsdiavewesngqpennyk, gfypsdiavewesngqpennyksubunit, subunitintact, intactstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntk, vvtvpssslgtqtyicnvnhkpsntkvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskname, nameepqvytlppsreemtknqvsltclvk, epqvytlppsreemtknqvsltclvkvvsvltvlhqdwlngkeykck, vvsvltvlhqdwlngkeykcknist, nistnqvsltclvk, nqvsltclvkmass, massvvsvltvlhqdwlngk, vvsvltvlhqdwlngkprotein
Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMS-9030 Using the Protein Metrics Software Suite
No. SSI-LCMS-103 SSI-LCMS-103 Liquid Chromatography Mass Spectrometry Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMSTM-9030 Using the Protein Metrics Software Suite No. LCMS-103 Stephen Kurzyniec, Vikki Johnson Shimadzu Scientific Instruments, Inc. ■ Abstract Accurate characterization of monoclonal antibodies is essential…
Key words
intact, intactprotein, proteinmetrics, metricstof, tofmab, mabsubunit, subunitdda, ddatemp, tempflow, flowdeconvoluted, deconvolutedmonoclonal, monoclonaldigestion, digestionsubunits, subunitsgas, gasenzymes
Intact & Subunit Analysis Using Reversed Phase - Agilent BioHPLC Columns Application Compendium
Agilent-NISTmAb Intact & Subunit Analysis Using Reversed Phase Agilent BioHPLC Columns Application Compendium Contents Agilent-NISTmAb Standard (P/N 5191-5744; 5191-5745) was aliquoted from NISTmAb RM 8671 batch. Quality control (QC) testing is performed using Agilent LC-MS system. QC batch release test…
Key words
counts, countsmab, mabherceptin, herceptinpage, pageintact, intactcontents, contentsbonds, bondsback, backdeglycosylated, deglycosylatedmass, massdeconvoluted, deconvolutedides, idesamu, amubravo, bravoassaymap
Qualitative Characterization and Quantitative Assessment of Monoclonal Antibodies Using Protein Metrics and nSMOLcoupled with the Shimadzu LCMS-9030 QTOF
Qualitative Characterization and Quantitative Assessment of Monoclonal Antibodies Using Protein Metrics and nSMOL coupled with the Shimadzu LCMS-9030 QTOF Vikki Johnson, Stephen Kurzyneic Shimadzu Scientific Instruments, Inc., Carlsbad, CA 800-477-1227 1. Introduction In this poster, we use the new LC-MS…
Key words
nsmol, nsmolmab, mabnist, nistselectively, selectivelyproteolysis, proteolysisspectrum, spectrumintact, intactfab, fabquantitation, quantitationdeconvoluted, deconvolutedprotein, proteinantibodies, antibodiesintertek, intertekserum, serumδmass
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike