Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030
Posters | 2024 | Shimadzu | ASMSInstrumentation
Monoclonal antibodies are vital in modern biopharmaceuticals due to their specificity and therapeutic potential
This work evaluates the NISTmAb reference material using high-resolution quadrupole time-of-flight LCMS to characterize intact mass, subunits, and peptide-level post-translational modifications
The approach combines enzymatic glycan removal and reduction, proteolytic digestion, and mass spectrometric analysis with specialized software
Intact mass deconvolution produced precise molecular weights within 20 Da of theoretical values
Subunit spectra revealed light and heavy chain glycoform distributions and identified key modifications
Peptide mapping achieved nearly complete sequence coverage and pinpointed modifications such as deamidation, oxidation, pyro-glutamate formation, and glycan heterogeneity
This workflow delivers a comprehensive critical quality attribute profile for monoclonal antibodies, supporting development, quality control, and regulatory submissions by quantifying protein variants and modifications
Emerging developments may include higher throughput multi-attribute methods, AI-driven data interpretation, real-time process analytics, and integration into continuous biomanufacturing platforms
The combination of Shimadzu Q-TOF LCMS-9030 and targeted sample preparation enables robust, high-resolution characterization of monoclonal antibodies, ensuring accurate assessment of structural integrity and critical modifications
LC/HRMS, LC/MS, LC/MS/MS, LC/TOF
IndustriesPharma & Biopharma
ManufacturerShimadzu
Summary
Significance of the Topic
Monoclonal antibodies are vital in modern biopharmaceuticals due to their specificity and therapeutic potential
Study Objectives and Overview
This work evaluates the NISTmAb reference material using high-resolution quadrupole time-of-flight LCMS to characterize intact mass, subunits, and peptide-level post-translational modifications
Methodology and Instrumentation
The approach combines enzymatic glycan removal and reduction, proteolytic digestion, and mass spectrometric analysis with specialized software
- Instrument: Shimadzu Q-TOF LCMS-9030
- Glycan removal enzyme: RapidTM PNGase F
- Protease: Trypsin
- Data analysis: Protein Metrics software
Main Results and Discussion
Intact mass deconvolution produced precise molecular weights within 20 Da of theoretical values
Subunit spectra revealed light and heavy chain glycoform distributions and identified key modifications
Peptide mapping achieved nearly complete sequence coverage and pinpointed modifications such as deamidation, oxidation, pyro-glutamate formation, and glycan heterogeneity
Benefits and Practical Applications
This workflow delivers a comprehensive critical quality attribute profile for monoclonal antibodies, supporting development, quality control, and regulatory submissions by quantifying protein variants and modifications
Future Trends and Potential Applications
Emerging developments may include higher throughput multi-attribute methods, AI-driven data interpretation, real-time process analytics, and integration into continuous biomanufacturing platforms
Conclusion
The combination of Shimadzu Q-TOF LCMS-9030 and targeted sample preparation enables robust, high-resolution characterization of monoclonal antibodies, ensuring accurate assessment of structural integrity and critical modifications
Reference
- Monoclonal Antibody (mAb) Intact Mass and Subunit Analysis Using Shimadzu Q-TOF LCMS-9030, 04-AD-0296-EN
- A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translation Modifications Study Using Shimadzu LCMS-9030 Q-TOF, AD-0295-EN
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF
2023|Shimadzu|Applications
Peptide Mapping Analysis of Monoclonal Antibody / LCMS-9030 Application News A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National…
Key words
gfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykmetrics, metricspeptide, peptideprotein, proteinmabs, mabsptm, ptmmodifications, modificationsstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqty, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyamino, aminoicnvnhkpsntk, icnvnhkpsntkxics, xicsmodified, modifiedvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskepqvytlppsreemtknqvsltclvk
Monoclonal Antibody (mAb) Intact Mass and Subunit Analysis Using Shimadzu Q-TOF LCMS-9030
2023|Shimadzu|Applications
Monoclonal Antibody Characterization / LCMS-9030 Application News Monoclonal Antibody (mAb) Intact Mass and Subunit Analysis Using Shimadzu Q-TOF LCMS-9030 Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National University of Singapore, Singapore 1 User Benefits …
Key words
antibody, antibodymass, massoxi, oxisubunit, subunitchain, chainintact, intactheavy, heavymonoclonal, monoclonallight, lightmolecular, molecularweight, weightdelta, deltaglycation, glycationanalysis, analysismab
Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMS-9030 Using the Protein Metrics Software Suite
2019|Shimadzu|Applications
No. SSI-LCMS-103 SSI-LCMS-103 Liquid Chromatography Mass Spectrometry Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMSTM-9030 Using the Protein Metrics Software Suite No. LCMS-103 Stephen Kurzyniec, Vikki Johnson Shimadzu Scientific Instruments, Inc. ■ Abstract Accurate characterization of monoclonal antibodies is essential…
Key words
intact, intactprotein, proteinmetrics, metricstof, tofmab, mabsubunit, subunitdda, ddatemp, tempflow, flowdeconvoluted, deconvolutedmonoclonal, monoclonaldigestion, digestionsubunits, subunitsgas, gasenzymes
Qualitative Characterization and Quantitative Assessment of Monoclonal Antibodies Using Protein Metrics and nSMOLcoupled with the Shimadzu LCMS-9030 QTOF
2019|Shimadzu|Posters
Qualitative Characterization and Quantitative Assessment of Monoclonal Antibodies Using Protein Metrics and nSMOL coupled with the Shimadzu LCMS-9030 QTOF Vikki Johnson, Stephen Kurzyneic Shimadzu Scientific Instruments, Inc., Carlsbad, CA 800-477-1227 1. Introduction In this poster, we use the new LC-MS…
Key words
nsmol, nsmolmab, mabnist, nistselectively, selectivelyproteolysis, proteolysisspectrum, spectrumintact, intactfab, fabquantitation, quantitationdeconvoluted, deconvolutedprotein, proteinantibodies, antibodiesintertek, intertekserum, serumδmass