LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Characterization of Monoclonal Antibody (mAb) using Shimadzu Q-TOF LCMS 9030

Posters | 2024 | Shimadzu | ASMSInstrumentation
LC/HRMS, LC/MS, LC/MS/MS, LC/TOF
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Significance of the Topic


Monoclonal antibodies are vital in modern biopharmaceuticals due to their specificity and therapeutic potential

Study Objectives and Overview


This work evaluates the NISTmAb reference material using high-resolution quadrupole time-of-flight LCMS to characterize intact mass, subunits, and peptide-level post-translational modifications

Methodology and Instrumentation


The approach combines enzymatic glycan removal and reduction, proteolytic digestion, and mass spectrometric analysis with specialized software
  • Instrument: Shimadzu Q-TOF LCMS-9030
  • Glycan removal enzyme: RapidTM PNGase F
  • Protease: Trypsin
  • Data analysis: Protein Metrics software

Main Results and Discussion


Intact mass deconvolution produced precise molecular weights within 20 Da of theoretical values
Subunit spectra revealed light and heavy chain glycoform distributions and identified key modifications
Peptide mapping achieved nearly complete sequence coverage and pinpointed modifications such as deamidation, oxidation, pyro-glutamate formation, and glycan heterogeneity

Benefits and Practical Applications


This workflow delivers a comprehensive critical quality attribute profile for monoclonal antibodies, supporting development, quality control, and regulatory submissions by quantifying protein variants and modifications

Future Trends and Potential Applications


Emerging developments may include higher throughput multi-attribute methods, AI-driven data interpretation, real-time process analytics, and integration into continuous biomanufacturing platforms

Conclusion


The combination of Shimadzu Q-TOF LCMS-9030 and targeted sample preparation enables robust, high-resolution characterization of monoclonal antibodies, ensuring accurate assessment of structural integrity and critical modifications

Reference

  1. Monoclonal Antibody (mAb) Intact Mass and Subunit Analysis Using Shimadzu Q-TOF LCMS-9030, 04-AD-0296-EN
  2. A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translation Modifications Study Using Shimadzu LCMS-9030 Q-TOF, AD-0295-EN

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF
Peptide Mapping Analysis of Monoclonal Antibody / LCMS-9030 Application News A Fast and Simple Workflow for Monoclonal Antibody (mAb) Post-Translational Modifications (PTM) Study Using Shimadzu LCMS-9030 Q-TOF Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National…
Key words
gfypsdiavewesngqpennykttppvldsdgsfflysk, gfypsdiavewesngqpennykttppvldsdgsfflyskgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykmetrics, metricspeptide, peptideprotein, proteinmabs, mabsptm, ptmmodifications, modificationsstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqty, stsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyamino, aminoicnvnhkpsntk, icnvnhkpsntkmodified, modifiedxics, xicsvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk, vqwkvdnalqsgnsqesvteqdskdstyslsstltlskepqvytlppsreemtknqvsltclvk
Monoclonal Antibody (mAb) Intact Mass and Subunit Analysis Using Shimadzu Q-TOF LCMS-9030
Monoclonal Antibody Characterization / LCMS-9030 Application News Monoclonal Antibody (mAb) Intact Mass and Subunit Analysis Using Shimadzu Q-TOF LCMS-9030 Shannie Tay1, Max Kosok1, Yu Jie Lee2 Shimadzu Asia Pacific, Singapore 2 National University of Singapore, Singapore 1 User Benefits …
Key words
antibody, antibodymass, masssubunit, subunitoxi, oxichain, chainintact, intactheavy, heavymonoclonal, monoclonallight, lightweight, weightmolecular, molecularglycation, glycationdelta, deltaanalysis, analysismab
Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMS-9030 Using the Protein Metrics Software Suite
No. SSI-LCMS-103 SSI-LCMS-103 Liquid Chromatography Mass Spectrometry Monoclonal Antibody Workflows on the Shimadzu Q-TOF LCMSTM-9030 Using the Protein Metrics Software Suite No. LCMS-103 Stephen Kurzyniec, Vikki Johnson Shimadzu Scientific Instruments, Inc. ■ Abstract Accurate characterization of monoclonal antibodies is essential…
Key words
intact, intactprotein, proteinmetrics, metricstof, tofmab, mabsubunit, subunitdda, ddatemp, tempflow, flowdeconvoluted, deconvolutedmonoclonal, monoclonaldigestion, digestionsubunits, subunitsgas, gasenzymes
Qualitative Characterization and Quantitative Assessment of Monoclonal Antibodies Using Protein Metrics and nSMOLcoupled with the Shimadzu LCMS-9030 QTOF
Qualitative Characterization and Quantitative Assessment of Monoclonal Antibodies Using Protein Metrics and nSMOL coupled with the Shimadzu LCMS-9030 QTOF Vikki Johnson, Stephen Kurzyneic Shimadzu Scientific Instruments, Inc., Carlsbad, CA 800-477-1227 1. Introduction In this poster, we use the new LC-MS…
Key words
nsmol, nsmolmab, mabnist, nistselectively, selectivelyproteolysis, proteolysisspectrum, spectrumintact, intactfab, fabquantitation, quantitationdeconvoluted, deconvolutedprotein, proteinantibodies, antibodiesserum, serumintertek, intertekmonoclonal
Other projects
GCMS
ICPMS
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike