Hypersil GOLD Peptide column for reliable monitoring of glycopeptide variants in monoclonal antibodies by LC-UV-MS analysis

Applications | 2024 | Thermo Fisher ScientificInstrumentation
Consumables, HPLC, LC/MS, LC columns, LC/SQ
Industries
Pharma & Biopharma, Proteomics
Manufacturer
Thermo Fisher Scientific

Summary

Significance of the Topic


Monitoring glycopeptide variants in mAb therapeutics is critical for ensuring product safety efficacy and consistency during development and manufacturing. This approach addresses the need for precise characterization of post translational modifications that impact biological activity and immunogenicity.

Aims and Study Overview


This study evaluates Thermo Scientific Hypersil GOLD Peptide column performance in LC UV SQMS analysis of tryptic digest of adalimumab. The aim is to demonstrate column to column and lot to lot reproducibility sensitivity and robustness for glycopeptide monitoring in a routine QC setting.

Methodology and Instrumentation


Sample preparation utilized SMART Digest Trypsin Kit combined with TCEP reduction and formic acid quench. Digests were pooled and stored at 6 C prior to analysis.
Chromatography employed a 150 by 2.1 mm 1.9 µm Hypersil GOLD Peptide column with water and acetonitrile mobile phases containing 0.1% formic acid under a gradient from 2 to 90 B over 27 minutes at 0.25 mL/min flow and 50 C.
Detection combined a Vanquish Flex UHPLC system with variable wavelength detector at 214 nm and an ISQ EM single quadrupole mass spectrometer in positive HESI mode using SIM scans for glycopeptide variants.

Main Results and Discussion


Column lot to lot reproducibility of retention time achieved %RSD ≤ 0.6 peak width %RSD ≤ 3.9 and peak area %RSD ≤ 6.2 across the chromatographic window. Glycopeptide variant quantification of A2G0F A2G1F and A2G2F showed relative abundance %RSD ≤ 5.2 between lots and ≤ 3.0 across columns. These metrics demonstrate stable peak shape retention and quantitation performance.

Benefits and Practical Applications


Hypersil GOLD Peptide columns offer the consistent reproducibility required for QC workflows in biopharma. Sharp symmetric peaks enable enhanced sensitivity and lower limits of quantification for glycoform profiling. The robust column performance supports high throughput analysis and method transferability.

Future Trends and Opportunities


Integration with high resolution MS architectures and automated sample handling will further increase throughput and depth of glycopeptide analysis. Expanded applications may include multiplexed PTM monitoring and real time process control in biomanufacturing.

Conclusion


Hypersil GOLD Peptide columns paired with LC UV SQMS deliver reliable reproducibility and sensitivity for monitoring mAb glycopeptide variants supporting routine QC and development studies in biopharmaceutical analysis.

References


  • Gucinski AC Boyne MT Evaluation of intact mass spectrometry for the quantitative analysis of protein therapeutics Analytical Chemistry 2012 84 18 8045 8051
  • Jefferis R Posttranslational modifications and the immunogenicity of biotherapeutics Journal of Immunology Research 2016 1 15

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Compliance-ready LC-UV-MS-based monitoring of antibody quality attributes using a single quadrupole mass spectrometer
Technical note | 003308 Pharma / Biopharma Compliance-ready LC-UV-MS-based monitoring of antibody quality attributes using a single quadrupole mass spectrometer Authors Application benefits Sylvia Grosse1, Michaela S. Scherz1, • The Thermo Scientific™ ISQ™ EM Single Quadrupole Mass Spectrometer (SQMS) enables…
Key words
digest, digestadalimumab, adalimumabsqms, sqmspeptide, peptidebeads, beadstrypsin, trypsinirc, ircsmart, smartmass, masssst, sstisq, isqcds, cdsfunctionality, functionalitytime, timespectrometer
Performance evaluation of a new reversed-phase column for peptide mapping and monitoring of monoclonal antibodies
Biopharmaceuticals Performance evaluation of a new reversed-phase column for peptide mapping and monitoring of monoclonal antibodies Sylvia Grossea, Michaela S. Scherza, Jonathan Turnerb, Silvia Millán-Martínc, Sara Carilloc, Jonathan Bonesc, Kai Schefflera, Serdar Bilgesoyd aThermo Fisher Scientific, Germering, Germany, bThermo Fisher…
Key words
peptide, peptidehypersil, hypersilmapping, mappingcolumn, columngold, goldlot, lotbars, barssst, sstperformance, performancedeam, deamchromatographic, chromatographicanalysis, analysisgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykevaluation, evaluationmonitoring
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticadalimumab
Analytical solutions for biopharmaceutical characterization and control
Analytical solutions for biopharmaceutical characterization and control
2021|Thermo Fisher Scientific|Brochures and specifications
Analytical solutions for biopharmaceutical characterization and control Your partner on every step of your journey Together we can address the challenges of biotherapeutic drug development Your molecules are complex Biotherapeutics such as monoclonal antibodies, biosimilars, antibody-drug conjugates, and nucleotide-based therapies…
Key words
characterization, characterizationdiscovery, discoveryworkflows, workflowsmonitoring, monitoringdevelopment, developmentprocess, processanalytical, analyticalmass, massorbitrap, orbitrapuhplc, uhplcdigest, digestvanquish, vanquishpeptide, peptideintact, intactanalysis
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike