Improved and universal inline electrochemical reduction and subunits LC-MS analysis of multiple classes of monoclonal antibodies
Applications | 2023 | Thermo Fisher ScientificInstrumentation
Monoclonal antibodies (mAbs) are critical biotherapeutics whose structural complexity demands robust analytical workflows. Traditional reduction methods rely on chemical reagents and extensive sample cleanup, which can compromise labile modifications and extend analysis times. Integrating inline electrochemical (EC) reduction with liquid chromatography–mass spectrometry (LC-MS) streamlines sample preparation, minimizes reagent use, and preserves sensitive glycoforms, supporting rapid and detailed characterization of mAbs in research and quality control settings.
This study aimed to develop and validate a universal inline EC-LC-MS workflow for mAb and subunit analysis across multiple IgG subclasses. Key objectives included:
The optimized platform combined an Antec Scientific ROXY Exceed potentiostat with a μ-PrepCell SS reactor, a Thermo Scientific Vanquish Tandem LC system, and a Thermo Scientific Q Exactive Plus Hybrid Quadrupole-Orbitrap mass spectrometer. Key parameters:
The inline EC-LC-MS workflow achieved complete reduction of intact mAbs and IdeS-digested subunits in 23.5 min without chemical reagents. Performance was consistent across IgG1 (rituximab), IgG2 (denosumab), and IgG4 (nivolumab), confirming universal applicability despite subclass-dependent disulfide arrangements. Analysis of cetuximab subunits revealed well-resolved isotopic profiles for scFc, Fd, and Lc with deconvoluted glycoform distributions. Relative abundances of sialylated species matched literature values, demonstrating that EC conditions do not degrade acid-labile modifications.
The presented workflow offers multiple advantages for biopharmaceutical analysis:
Inline EC-LC-MS is poised to evolve further, with potential developments including:
This optimized inline EC-LC-MS workflow delivers rapid, universal, and reagent-free reduction of mAbs and their subunits, preserving sensitive modifications and supporting detailed structural profiling across IgG subclasses. Its simplicity and robustness make it an attractive solution for routine analytical and quality control laboratories in the biopharmaceutical industry.
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
IndustriesPharma & Biopharma
ManufacturerThermo Fisher Scientific
Summary
Significance of Inline Electrochemical Reduction in mAb Analysis
Monoclonal antibodies (mAbs) are critical biotherapeutics whose structural complexity demands robust analytical workflows. Traditional reduction methods rely on chemical reagents and extensive sample cleanup, which can compromise labile modifications and extend analysis times. Integrating inline electrochemical (EC) reduction with liquid chromatography–mass spectrometry (LC-MS) streamlines sample preparation, minimizes reagent use, and preserves sensitive glycoforms, supporting rapid and detailed characterization of mAbs in research and quality control settings.
Goals and Study Overview
This study aimed to develop and validate a universal inline EC-LC-MS workflow for mAb and subunit analysis across multiple IgG subclasses. Key objectives included:
- Demonstrating complete disulfide bond reduction inline without chemical reducing agents.
- Verifying method compatibility with intact mAbs and IdeS-digested subunits (Lc, Fd, scFc).
- Ensuring accurate profiling of acid-labile modifications such as sialylated N-glycans.
- Applying the workflow to diverse antibody classes (IgG1, IgG2, IgG4) and a heterogeneous drug product (cetuximab).
Methodology and Instrumentation
The optimized platform combined an Antec Scientific ROXY Exceed potentiostat with a μ-PrepCell SS reactor, a Thermo Scientific Vanquish Tandem LC system, and a Thermo Scientific Q Exactive Plus Hybrid Quadrupole-Orbitrap mass spectrometer. Key parameters:
- Electrochemical reduction: 1 V square-wave pulse (1 s reduction, 0.1 s clean) at 60 °C in 20% acetonitrile, 1% formic acid.
- Trap and analytical columns: MAbPac RP (2.1 × 50 mm trap; 2.1 × 100 mm analytical) with gradient elution over 23.5 min.
- MS settings: positive ion mode, 3.8 kV spray voltage, m/z 600–5000, resolution up to 140 000 for subunits.
- Sample prep: buffer exchange into 1% formic acid, 20% ACN; IdeS digestion for subunit generation; vacuum centrifugation and resuspension.
Main Results and Discussion
The inline EC-LC-MS workflow achieved complete reduction of intact mAbs and IdeS-digested subunits in 23.5 min without chemical reagents. Performance was consistent across IgG1 (rituximab), IgG2 (denosumab), and IgG4 (nivolumab), confirming universal applicability despite subclass-dependent disulfide arrangements. Analysis of cetuximab subunits revealed well-resolved isotopic profiles for scFc, Fd, and Lc with deconvoluted glycoform distributions. Relative abundances of sialylated species matched literature values, demonstrating that EC conditions do not degrade acid-labile modifications.
Benefits and Practical Applications
The presented workflow offers multiple advantages for biopharmaceutical analysis:
- Single-platform reduction and LC-MS analysis without chemical reducing agents.
- Elimination of extra cleanup steps, reducing hands-on time and potential sample loss.
- Maintenance of labile post-translational modifications, enabling reliable quantitation of sialylated glycans.
- Scalability to various mAb subclasses and complex drug products.
Future Trends and Applications
Inline EC-LC-MS is poised to evolve further, with potential developments including:
- Integration with automated sample preparation and real-time data analysis for high-throughput screening.
- Extension to other biotherapeutic formats, such as bispecific antibodies and fusion proteins.
- Miniaturized EC cells for low-volume and single-cell applications.
- Coupling with alternative detectors (e.g., ion mobility) to enhance proteoform separation and characterization.
Conclusion
This optimized inline EC-LC-MS workflow delivers rapid, universal, and reagent-free reduction of mAbs and their subunits, preserving sensitive modifications and supporting detailed structural profiling across IgG subclasses. Its simplicity and robustness make it an attractive solution for routine analytical and quality control laboratories in the biopharmaceutical industry.
Reference
- Morgan T.E. et al. Analyst 2021, 146(21), 6547–6555.
- Füssl F. et al. Anal. Chem. 2020, 92(7), 5431–5438.
- Ayoub D. et al. mAbs 2013, 5(5), 699–710.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Antibody subunit analysis via inline electrochemical reduction of an intact antibody using the ROXY potentiostat coupled to a Vanquish UHPLC – Q Exactive Plus MS system
2022|Thermo Fisher Scientific|Applications
Application note | 000462 Mass spectrometry Antibody subunit analysis via inline electrochemical reduction of an intact antibody using the ROXY potentiostat coupled to a Vanquish UHPLC – Q Exactive Plus MS system Application benefits Authors Tomos E. Morgan , Craig…
Key words
electrochemical, electrochemicalreduction, reductionroxy, roxydisulfide, disulfidepotentiostat, potentiostatcell, cellvanquish, vanquishexceed, exceedbonds, bondselectrode, electrodeantibody, antibodyinline, inlineprepcell, prepcellscientific, scientificthermo
In-depth characterization of monoclonal antibodies
2024|Thermo Fisher Scientific|Applications
Technical note | 003318 Biopharma In-depth characterization of monoclonal antibodies Intact mass analysis and middle-down mass spectrometry approaches on an Orbitrap Ascend BioPharma Tribrid mass spectrometer Authors Goal Jingjing Huang, Christopher Mullen, To assess the performance of the Thermo Scientific™…
Key words
trastuzumab, trastuzumabsubunits, subunitsintact, intactuvpd, uvpdactivation, activationtype, typeethcd, ethcdarb, arbmass, massorbitrap, orbitrapparameters, parametersascend, ascendfragmentation, fragmentationscan, scantrue
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Applications
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Key words
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticsrwqqgnvfscsvmhealhnhytqk
High Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer
2015|Thermo Fisher Scientific|Posters
this study we have analyzed two commercially available drug products: rituximab (trade names MabThera and Rituxan®) and denosumab (trade names Prolia® and XGEVA®). FIGURE 1. General structure of mAbs and their biological and physico-chemical characteristics. Physicochemical Characteristics Biological Characteristics High…
Key words
chain, chainheavy, heavyrituximab, rituximabmodifications, modificationspeptide, peptidemodification, modificationgradient, gradientmapping, mappingexactive, exactivedifferent, differentheterogeneity, heterogeneitysequence, sequenceprolia, proliaterminal, terminallight