Temperature Dependence on Reversed- Phase Separations of Fatty Acid Modified GLP-1 Receptor Agonists and Their Impurities
Applications | 2024 | WatersInstrumentation
GLP-1 receptor agonists modified with fatty acids are critical therapeutics for diabetes and obesity management. Their growing demand requires robust analytical methods to detect trace impurities that may affect safety and efficacy. Reversed-phase liquid chromatography with precise thermal control emerges as a key tool to ensure reliable impurity profiling.
This study evaluates how small variations in column temperature influence the reversed-phase separation of three fatty acid modified GLP-1 receptor agonists—liraglutide, semaglutide, and tirzepatide—and their impurity profiles. The goal is to demonstrate temperature as a tunable parameter to optimize resolution of critical impurity species.
The method employs an ACQUITY Premier UPLC system with:
Increasing column temperature shifts analyte and impurity elution to earlier retention times. Relative retention time differences (ΔRRT) and peak-to-valley ratios reveal that:
Advancements may include integration of temperature-programmable column ovens with mass spectrometry for enhanced characterization of lipopeptides. Automated temperature feedback systems and high-throughput screening of thermal conditions can further streamline method robustness. Extending these principles to a broader range of fatty acid-modified biotherapeutics will support evolving pharmaceutical demands.
Column temperature is a critical variable in reversed-phase separations of fatty acid modified GLP-1 receptor agonists. Minor thermal adjustments significantly affect impurity selectivity, underscoring the importance of rigorous temperature control and instrumentation capable of stable heating for consistent analytical performance.
HPLC
IndustriesPharma & Biopharma
ManufacturerWaters
Summary
Significance of the Topic
GLP-1 receptor agonists modified with fatty acids are critical therapeutics for diabetes and obesity management. Their growing demand requires robust analytical methods to detect trace impurities that may affect safety and efficacy. Reversed-phase liquid chromatography with precise thermal control emerges as a key tool to ensure reliable impurity profiling.
Objectives and Study Overview
This study evaluates how small variations in column temperature influence the reversed-phase separation of three fatty acid modified GLP-1 receptor agonists—liraglutide, semaglutide, and tirzepatide—and their impurity profiles. The goal is to demonstrate temperature as a tunable parameter to optimize resolution of critical impurity species.
Methodology and Instrumentation
The method employs an ACQUITY Premier UPLC system with:
- ACQUITY Premier Peptide CSH C18 column (1.7 µm, 2.1 × 150 mm)
- Mobile phase A: 0.1% TFA in water; B: 0.1% TFA in acetonitrile
- Column temperatures set at 55, 60, and 65 °C; sample maintained at 6 °C
- Injection volume of 5 µL and UV detection at 214 nm
Main Results and Discussion
Increasing column temperature shifts analyte and impurity elution to earlier retention times. Relative retention time differences (ΔRRT) and peak-to-valley ratios reveal that:
- For certain impurity pairs, resolution improves with higher temperature due to larger ΔRRT of the early-eluting species
- Conversely, some impurity pairs co-elute at elevated temperatures, indicating an optimum at lower temperatures
Benefits and Practical Applications
- Enables targeted optimization of impurity separation by adjusting column temperature
- Highlights the necessity for precise thermal management in quality control workflows
- Provides a framework for method development in peptide-based therapeutics
Future Trends and Potential Applications
Advancements may include integration of temperature-programmable column ovens with mass spectrometry for enhanced characterization of lipopeptides. Automated temperature feedback systems and high-throughput screening of thermal conditions can further streamline method robustness. Extending these principles to a broader range of fatty acid-modified biotherapeutics will support evolving pharmaceutical demands.
Conclusion
Column temperature is a critical variable in reversed-phase separations of fatty acid modified GLP-1 receptor agonists. Minor thermal adjustments significantly affect impurity selectivity, underscoring the importance of rigorous temperature control and instrumentation capable of stable heating for consistent analytical performance.
References
- Watanabe JH, Kown J, Nan B, Reikes A. Trends in Glucagon-Like Peptide 1 Receptor Agonist Use, 2014 to 2022. J Am Pharm Assoc. 64:133–138. 2024.
- Clements BR, Rainville P. Development of Separation Methods for GLP-1 Synthetic Peptides Utilizing a Systematic Protocol and MaxPeak High Performance Surface Technology. Waters Application Note. 2024.
- Hanna CM, Koza SM, Shiner S. Column Selection for RPLC-UV Impurity Analysis of Fatty Acid Modified GLP-1 Receptor Agonists. Waters Application Note. 2024.
- Li Z, Hong P, McConville PR. The Importance of Column Compartment Thermostatting and Preheating for Temperature Sensitive Separations in Liquid Chromatography. Waters Application Note. 2021.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Column Selection for RPLC-UV Impurity Analysis of Fatty Acid Modified GLP-1 Receptor Agonists
2024|Waters|Applications
Application Note Column Selection for RPLC-UV Impurity Analysis of Fatty Acid Modified GLP-1 Receptor Agonists Caitlin M. Hanna, Stephan M. Koza, Steve Shiner Waters Corporation Abstract Here, we screen four column chemistries for the RPLC-UV impurity analyses of liraglutide and…
Key words
semaglutide, semaglutideimpurity, impurityliraglutide, liraglutideseparation, separationcolumns, columnsrplc, rplcreveals, revealstfa, tfaselection, selectionlipopeptide, lipopeptidevariants, variantsprivacy, privacyfatty, fattygradient, gradienttailoring
Method Development for Forced Degradation of Small Molecule GLP-1 Agonist Orforglipron
2025|Waters|Applications
Application Note Method Development for Forced Degradation of Small Molecule GLP-1 Agonist Orforglipron Melissa Aiello, Christopher Collins, Thomas H Walter Waters Corporation, United States Published on November 26, 2025 Abstract Orforglipron is a novel non-peptide GLP-1 RA (glucagon-like peptide receptor…
Key words
orforglipron, orforglipronforced, forcedacquity, acquityimpurities, impuritiesempower, empowerpda, pdaprivacy, privacyapi, apistressing, stressingdegradation, degradationcds, cdsbasic, basicuplc, uplcspectrally, spectrallyshape
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutidetirzepatide, tirzepatideoxidation, oxidationsemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance
HILIC Analysis of GLP-1 Receptor Agonists
2025|Agilent Technologies|Applications
Application Note Pharma HILIC Analysis of GLP-1 Receptor Agonists Using an Agilent 1290 Infinity III Bio LC with DAD and ELSD Authors Piotr Alvarez, Cindy Lecluyse, Ine Vandendriessche, Pat Sandra, and Koen Sandra RIC group President Kennedypark 6, 8500 Kortrijk,…
Key words
exenatide, exenatidesemaglutide, semaglutidebyetta, byettaelsd, elsdozempic, ozempicliraglutide, liraglutidehilic, hilicxultophy, xultophyresponse, responsetirzepatide, tirzepatidedeactivated, deactivatedsst, sststainless, stainlesssteel, steelmau