Offline tandem MSn workflows on the timsOmni platform for deep sequencing of intact proteins and mAbs

Posters | 2025 | Bruker | ASMSInstrumentation
LC/MS, LC/MS/MS, LC/TOF, LC/HRMS, Ion Mobility, Software
Industries
Pharma & Biopharma
Manufacturer
Bruker

Summary

Importance of the topic


The application of top-down mass spectrometry (TDMS) to intact proteins and monoclonal antibodies (mAbs) promises detailed sequence information and disulfide bond characterization. However, challenges such as signal dilution across multiple charge states, overlapping isotopic envelopes, and limited sequence coverage have impeded broad adoption in structural and quality control workflows.

Objectives and study overview


This work demonstrates novel offline tandem MSn workflows on the timsOmni platform to enhance deep sequencing of non‐reduced intact mAbs. The study aims to integrate in‐source collision‐induced dissociation (isCID) with multiple-stage activations (ECD, EID, RCID) to achieve comprehensive sequence mapping and disulfide bond analysis.

Methodology


  • Sample preparation: NISTmAb diluted to 3.3 µM in 50:50 H2O/ACN with 0.1% formic acid.
  • Electrospray ionization: NEOS nanoESI source at ~1.2 kV.
  • Offline MSn: isCID for subunit release, followed by MS2 CID, MS3 ECD/EID, and MS4 RCID in the Omnitrap cell.
  • Data acquisition: Extended scan averaging across charge states (e.g., 49+, 52+, 55+), with reaction times of 50 ms and accumulation of products for ~1 s.
  • Data analysis: OmniScape software for sequence mapping and fragment annotation.

Instrumentation


  • timsOmni mass spectrometer with integrated Omnitrap section.
  • High‐capacity orthogonal acceleration time‐of‐flight (OA‐TOF) analyzer (>5×106 charges/ms).
  • NEOS nanoESI ion source and coated nanospray tips.
  • Quadrupole mass filters for precursor and fragment selection.

Main results and discussion


  • MS2 CID generated abundant b‐type ions, which were selectively processed through MS3 ECD/EID and MS4 RCID stages.
  • Combined multimodal fragmentation yielded sequence coverages up to 88% for heavy‐chain fragments and over 80% for light chain regions.
  • ps.MS3 ECD of light chain 10+ precursor delivered near‐complete coverage outside intrachain disulfide loops; subsequent RCID of charge‐reduced ions achieved full reduction of the first disulfide bond.
  • Partial reduction of intrachain bonds in heavy‐chain fragments indicated differential accessibility and highlighted the method’s capability for disulfide mapping.

Benefits and practical applications


  • Enhanced sequence coverage for intact, non‐reduced mAbs supports detailed structural characterization.
  • Capability for targeted disulfide bond analysis informs biotherapeutic quality control and comparability studies.
  • Offline MSn workflows increase flexibility for complex sample types and extended scan durations.

Future trends and potential applications


  • Integration of timsOmni MSn approaches into automated QC pipelines for biologics manufacturing.
  • Expansion to native TDMS for intact protein complexes and multi‐subunit assemblies.
  • Development of real‐time data processing algorithms for rapid fragment annotation and decision support.

Conclusion


Offline isCID‐MSn methodologies on the timsOmni platform provide a powerful strategy for deep sequencing and disulfide bond mapping of intact non‐reduced mAbs. The combination of complementary fragmentation modes and high‐capacity instrumentation addresses key limitations of conventional TDMS, paving the way for robust structural analyses in research and industrial settings.

Reference


No references provided in the original document.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Advances in hardware design and function of the new timsOmni MS platform
AS MS 2 0 2 5 – M P 4 7 1 Advances in hardware design and function of the new timsOmni MS platform D. Papanastasiou1; A. Smyrnakis1; M. Kosmopoulou1; A. Grigoriadis1; I. Orfanopoulos1; N. Manolis1; I. Panagiotopoulos1; R. Gioves1;…
Key words
eid, eidecd, ecdtims, timstimsomni, timsomniciu, ciuactivation, activationexd, exdelectron, electronomnitrap, omnitrapaccu, accuion, ionplatform, platformunfolding, unfoldingacq, acqcollisional
Applying cDDA-eXd on a timsOmni to the analysis of the Fab regions of antibodies originating from human serum
Applying cDDA-eXd on a timsOmni to the analysis of the Fab regions of antibodies originating from human serum Simon Ollivier1,2, Manuel Bauer5, Dina Schuster1,2, Athanasios Smyrnakis3, Jan Fiala1,2, Stuart Pengelley4, Oliver Raether4, Mariangela Kosmopoulou3, Detlev Suckau4, Jean-François Greisch1,5, Dimitris Papanastasiou3…
Key words
timsomni, timsomnicdda, cddafabs, fabsomnitrap, omnitrapprotein, proteintzb, tzbecd, ecdcharge, chargeheterogeneity, heterogeneityproteoform, proteoformregions, regionsproteoforms, proteoformscam, camions, ionsoriginating
Top-Down CDR Sequencing of Native Intact mAbs Through Deconvolution of HC+LC Mixture Spectra
Poster Reprint ASMS 2024 Poster number ThP 025 Top-Down CDR Sequencing of Native Intact mAbs Through Deconvolution of HC+LC Mixture Spectra Lily E. Miller1; Stephanie Sturgeon2; Yury V. Vasilev2; Rachel Franklin2; Blake Hakkila2; Timothy Djang3; Alex Gavrilenko3; Jhenya Gavrilenko3; Panos…
Key words
matchmaking, matchmakingchain, chainion, ionexdviewer, exdviewerintact, intactfragmentation, fragmentationexd, exdecd, ecdcorrect, correctnative, nativeunlikely, unlikelyheavy, heavydisabled, disabledregion, regionmatch
Top-down sequencing of bispecific antibodies by electron capture dissociation on a timsOmni platform
Top-down sequencing of bispecific antibodies by electron capture dissociation on a timsOmni platform Iuliia Stroganova1,2, Simon Ollivier1,2, Jean-François Greisch1,5, Athanasios Smyrnakis3, Mariangela Kosmopoulou3, Detlev Suckau4, Dimitris Papanastasiou3 and Albert J.R. Heck1,2 1Biomolecular Mass Spectrometry & Proteomics, NL, 2Netherlands Proteomics Center,…
Key words
timsomni, timsomniglycan, glycanbsabs, bsabscapture, captureomnitrap, omnitrapelectron, electronbispecific, bispecificbridges, bridgesides, idesfab, fabtop, topcqqyyrspltfgggtkveikrtvaapsvfifppsdeqlks, cqqyyrspltfgggtkveikrtvaapsvfifppsdeqlkscvrsvtprycgggfcygefdywgqgtlvtvssstkgpsvfplapssks, cvrsvtprycgggfcygefdywgqgtlvtvssstkgpsvfplapssksdown, downdisulfide
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike