Characterizing 32-plex TMTpro reagents for high-throughput quantitative proteomics on Orbitrap platforms

Posters | 2025 | Thermo Fisher Scientific | ASMSInstrumentation
LC/HRMS, LC/Orbitrap, LC/MS/MS, LC/MS, Software
Industries
Proteomics
Manufacturer
Thermo Fisher Scientific

Summary

Importance of the Topic


Isobaric tagging strategies are essential in modern proteomics to compare protein abundances across multiple samples in a single experiment. The development of high-plex reagents enhances throughput, reduces instrument time and sample consumption, and supports large-scale studies in areas such as biomarker discovery and quality control.

Aims and Study Overview


This study evaluates a novel set of deuterated TMTpro reagents that introduce a 3 mDa mass shift, expanding multiplexing from 18 to 32 channels on Orbitrap platforms. The objectives include assessing reporter ion resolution, quantification accuracy, retention time behavior, and overall proteome coverage compared to existing TMTpro reagents.

Methodology and Used Instrumentation


HeLa S3 cell lysates were digested, labeled with 32-plex TMTpro reagents (16 traditional and 16 deuterated isotopologues), and combined at defined ratios. Peptides underwent nanoflow reversed-phase LC on a 50 cm C18 EASY-Spray column with a 2–32 % ACN gradient over 120 min at 300 nL/min. MS acquisition employed:
  • Thermo Scientific Orbitrap Eclipse Tribrid mass spectrometer
  • Thermo Scientific Vanquish Neo UHPLC system
  • FT-MS¹ scans at 120K resolving power (200 m/z)
  • HCD FT-MS² scans at varying resolving powers (TurboTMT 45K, eFT 75K, up to 120K)
  • Data-dependent acquisition with 3 sec cycle and 60 sec dynamic exclusion
  • Optional RTS SPS-MS³ for improved quantitation
Raw data were processed in Proteome Discoverer 3.2 using SEQUEST HT and Percolator, with reporter ions integrated within an 11 ppm window.

Main Results and Discussion


Resolution experiments show 3 mDa reporter ions are 5 % separated at 75K and baseline resolved at ≥90K. Quantitative tests demonstrate:
  • Equivalent accuracy and precision for 32-plex vs. 16-plex at optimized resolving powers (CVs ~6–8 %).
  • Retention time shift of 0.5–1 sec between deuterated and non-deuterated channels, correctable via software normalization.
  • 32-plex analyses yield 15 % more quantified proteins and 39 % more peptides than two bridged 18-plex runs, reducing missing values.
  • Offline high-pH fractionation doubled proteome coverage with over 6 400 proteins quantified in 32-plex.

Benefits and Practical Applications


The expanded 32-plex TMTpro workflow offers:
  • High sample throughput in a single LC-MS/MS run
  • Reduced instrument time and reagent cost per sample
  • Robust quantification with minimal missing data
  • Compatibility with existing Orbitrap platforms and software tools

Future Trends and Opportunities


Advances may include further multiplexing beyond 35 channels, integration of real-time search algorithms, improved normalization methods, and automation of sample preparation. Emerging mass analyzers with higher resolution will enhance separation of closely spaced reporters and support deeper proteome coverage.

Conclusion


The new deuterated TMTpro reagents reliably extend multiplexing to 32 channels on Orbitrap instruments without compromising performance. They deliver equivalent accuracy, improved throughput, and simplified workflows for high-throughput quantitative proteomics.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Expanding TMTpro reagents to 32-plex for high-throughput quantitative proteomics on Orbitrap platforms
P-I-0120 Expanding TMTpro reagents to 32-plex for high-throughput quantitative proteomics on Orbitrap platforms Dustin Frost1, Joao A. Paulo2, Steven P. Gygi2, Karsten Kuhn3, Ian Pike3, Ryan Bomgarden1 2Harvard Medical School, Boston, MA, USA 3Proteome Sciences, London, UK Figure 8. TMTpro…
Key words
deuterated, deuteratedtmtpro, tmtproturbotmt, turbotmtquantified, quantifiedreferenced, referencedorbitrap, orbitrapchannels, channelslabeled, labeledsets, setspeptides, peptidesnon, nonhela, helathermo, thermoabundance, abundancescientific
Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer
Poster # P-I-0130 Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer Jingjing Huang1, Dustin Frost2, David Bergen1, Ryan D. Bomgarden2, Rosa Viner1, Graeme McAlister1,…
Key words
deuterated, deuteratedchannels, channelsnormalized, normalizedagc, agcreporter, reporterabundance, abundanceorbitrap, orbitrapquan, quanabundances, abundancesexlusion, exlusionnondeuterated, nondeuteratedeqsgtiylqhadeerek, eqsgtiylqhadeerekgavaedgdelrtepeak, gavaedgdelrtepeakvvadgaglpgedwvfvssk, vvadgaglpgedwvfvsskgroups
Enhancing protein quantification and sample throughput with TMTpro 32plex label reagents and extended supporting features from the Orbitrap Ascend MultiOmics mass spectrometer
Technical note | 004339 Mass spectrometry Enhancing protein quantification and sample throughput with TMTpro 32plex label reagents and extended supporting features from the Orbitrap Ascend MultiOmics mass spectrometer Authors Goal Julia Kraegenbring , Jingjing Huang , 1 This study evaluates…
Key words
turbotmt, turbotmteft, eftascend, ascendmultiomics, multiomicsorbitrap, orbitrapdeuterated, deuteratedneo, neoquantified, quantifiedabundances, abundancesplexes, plexesgroups, groupsreporter, reportertrue, trueequilibration, equilibrationrts
Enhancing the resolving power on an Orbitrap Astral Zoom mass spectrometer for TMTPro 35plex applications
Proteomics Enhancing the resolving power on an Orbitrap Astral Zoom mass spectrometer for TMTPro 35plex applications Julia Kraegenbring1; Martin Zeller1; Tabiwang N. Arrey1, Bernard Delanghe1; Christopher Rathje1; Eduard Denisov1; Robert Ostermann1; Florian Bonn1; Alexander Wagner1; Dustin Frost2; Ryan Bomgarden2; Eugen…
Key words
groups, groupsquantified, quantifiedquan, quantmt, tmtpeptide, peptidereporter, reporterastral, astralprotein, proteinidentified, identifiedknocked, knockedagc, agcscheme, schemenovel, novelscan, scanintegration
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike