Expanding TMTpro reagents to 32-plex for high-throughput quantitative proteomics on Orbitrap platforms

Posters | 2024 | Thermo Fisher Scientific | HUPOInstrumentation
LC/MS, LC/Orbitrap, LC/HRMS, Software, LC/MS/MS
Industries
Proteomics
Manufacturer
Thermo Fisher Scientific

Summary

Importance of the Topic


Isobaric mass tags have revolutionized multiplexed quantitative proteomics by enabling simultaneous analysis of many samples in a single LC–MS/MS run. Expanding the sample throughput from 18-plex to 32-plex greatly accelerates large-cohort studies, improves statistical power, and reduces instrument time and cost per sample.

Objectives and Study Overview


This work describes the development of a deuterated TMTpro reagent set that adds 17 new reporter ion masses separated by 3 mDa, enabling up to 35-plex analysis on Orbitrap platforms. The primary goal was to characterize the chemical synthesis, labeling efficiency, chromatographic behavior, and quantitative performance of the new 32-plex configuration in comparison with existing 16- and 18-plex formats.

Methodology and Instrumentation


Peptides from HeLa cell digests and protein standards were labeled with traditional and deuterated TMTpro tags using a Thermo Scientific EasyPep workflow. Labeled samples were analyzed on a Thermo Scientific Orbitrap Eclipse Tribrid mass spectrometer coupled to a Vanquish Neo UHPLC with a 50 cm C18 EASY-Spray column. Data were acquired using high-resolution MS1 at 120 K (200 m/z) and HCD FT-MS2 at RP ≥ 75 K or TurboTMT 45 K, as well as RTS SPS-MS3 experiments. Data processing employed Proteome Discoverer 3.0 with SEQUEST HT, UniProt human database, 1% FDR, and reporter-ion integration within an 11 ppm window.

Main Results and Discussion


• Deuterated reporters achieved ~98% deuterium incorporation and labeling efficiency ≥ 99.5% at peptide N-termini and lysine residues.
• Slight retention time shifts of deuterated channels were observed; separate referencing to a matching control channel corrects biases.
• Reporter ions spaced by 3 mDa were baseline-resolved at RP ≥ 75 K (200 m/z) and TurboTMT 45 K, with CVs of 6.4–7.7% within each 16-plex subset and 17% across sets.
• Quantitative performance of 32-plex HCD FT-MS2 matched that of 16-plex and 18-plex formats.
• In RTS SPS-MS3 mode, a single 32-plex run quantified ~15% more proteins and ~39% more peptides than two bridged 18-plex experiments.

Benefits and Practical Applications


• High-throughput profiling of up to 32 samples in one LC–MS/MS run reduces missing data and experimental variability.
• Cost and time savings support large-scale biomarker discovery, drug screening, and clinical proteomics workflows.
• Compatibility with existing TMTpro workflows facilitates easy adoption without significant protocol changes.

Future Trends and Applications


• Extension to full 35-plex workflows combining all reporter sets.
• Integration with data-independent acquisition and advanced quantification algorithms.
• Application in multi-omic and spatial proteomics to maximize sample throughput.
• Automated normalization strategies for cross-set comparisons in longitudinal studies.

Conclusion


The deuterated TMTpro reagent set successfully expands multiplexing capability to 32-plex on Orbitrap platforms without compromising quantitative accuracy, precision, or proteome coverage. This innovation enables more efficient large-scale proteomic experiments and opens new avenues for high-throughput biological and clinical research.

Used Instrumentation


  • Orbitrap Eclipse Tribrid mass spectrometer (Thermo Scientific)
  • Vanquish Neo UHPLC system with 50 cm C18 EASY-Spray column (Thermo Scientific)
  • EasyPep MS sample preparation kit and SPE cleanup (Thermo Scientific)

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Characterizing 32-plex TMTpro reagents for high-throughput quantitative proteomics on Orbitrap platforms
Characterizing 32-plex TMTpro reagents for high-throughput quantitative proteomics on Orbitrap platforms Dustin Frost1, Frank Berg2, Kai Fritzemeier2, Pedro Navarro2, David M. Horn3, Ryan Bomgarden1 Figure 1. TMTpro 35-plex isotopic configurations 560.980 m/z (+3) 127D:127C 13C 127.12476 m/z Learn more at…
Key words
deuterated, deuteratedtmtpro, tmtproturbotmt, turbotmtquantified, quantifiedchannels, channelsreferenced, referencedabundances, abundancespeptides, peptidesabundance, abundancelabeled, labeledsets, setsorbitrap, orbitrapthermo, thermoproteins, proteinstag
Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer
Poster # P-I-0130 Enhancing protein quantification and sample throughput with TMTpro 32-plex reagents and extended supporting features from the Thermo Scientific Orbitrap Ascend MultiOmics Tribrid Mass Spectrometer Jingjing Huang1, Dustin Frost2, David Bergen1, Ryan D. Bomgarden2, Rosa Viner1, Graeme McAlister1,…
Key words
deuterated, deuteratedchannels, channelsnormalized, normalizedagc, agcreporter, reporterabundance, abundanceorbitrap, orbitrapquan, quanabundances, abundancesexlusion, exlusionnondeuterated, nondeuteratedeqsgtiylqhadeerek, eqsgtiylqhadeerekgavaedgdelrtepeak, gavaedgdelrtepeakvvadgaglpgedwvfvssk, vvadgaglpgedwvfvsskplexes
Enhancing protein quantification and sample throughput with TMTpro 32plex label reagents and extended supporting features from the Orbitrap Ascend MultiOmics mass spectrometer
Technical note | 004339 Mass spectrometry Enhancing protein quantification and sample throughput with TMTpro 32plex label reagents and extended supporting features from the Orbitrap Ascend MultiOmics mass spectrometer Authors Goal Julia Kraegenbring , Jingjing Huang , 1 This study evaluates…
Key words
turbotmt, turbotmteft, eftascend, ascendmultiomics, multiomicsorbitrap, orbitrapdeuterated, deuteratedneo, neoquantified, quantifiedplexes, plexesabundances, abundancesgroups, groupsreporter, reportertrue, trueequilibration, equilibrationrts
Enhancing the resolving power on an Orbitrap Astral Zoom mass spectrometer for TMTPro 35plex applications
Proteomics Enhancing the resolving power on an Orbitrap Astral Zoom mass spectrometer for TMTPro 35plex applications Julia Kraegenbring1; Martin Zeller1; Tabiwang N. Arrey1, Bernard Delanghe1; Christopher Rathje1; Eduard Denisov1; Robert Ostermann1; Florian Bonn1; Alexander Wagner1; Dustin Frost2; Ryan Bomgarden2; Eugen…
Key words
groups, groupsquantified, quantifiedquan, quantmt, tmtpeptide, peptidereporter, reporterastral, astralprotein, proteinidentified, identifiedknocked, knockedagc, agcscheme, schemenovel, novelscan, scanintegration
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike