Revolutionizing translational research: large-scale targeted PRM proteomics assays enabled by Stellar mass spectrometer
Posters | 2025 | Thermo Fisher Scientific | ASMSInstrumentation
Large-scale targeted proteomics is crucial for biomarker verification in translational and clinical research. High-throughput, multiplexed assays enable sensitive and specific quantification of hundreds to thousands of peptides in complex matrices such as plasma, accelerating discovery pipelines and supporting regulatory applications.
This work presents a streamlined workflow for developing and validating large-scale parallel reaction monitoring (PRM) assays on the Thermo Scientific Stellar mass spectrometer. The study focuses on creating assays for a 500-peptide reference panel (PQ500) using optimized chromatographic gradients (60SPD and 100SPD) and evaluating analytical performance including reproducibility, linearity, limits of detection (LOD), and limits of quantification (LOQ).
Emerging directions include integration with gas-phase fractionation DIA for seamless discovery-to-validation pipelines, incorporation of novel chromatographic modalities to boost throughput, and application of machine learning for real-time transition selection and method refinement in large-scale targeted assays.
The combination of the Stellar mass spectrometer, Skyline, and PRM Conductor delivers a robust, high-throughput solution for large-scale targeted proteomics. It achieves excellent sensitivity, reproducibility, and streamlined assay development, making it well suited for biomarker verification and translational studies.
LC/HRMS, LC/Orbitrap, LC/MS/MS, LC/MS, Sample Preparation, Software
IndustriesClinical Research, Proteomics
ManufacturerThermo Fisher Scientific
Summary
Significance of the topic
Large-scale targeted proteomics is crucial for biomarker verification in translational and clinical research. High-throughput, multiplexed assays enable sensitive and specific quantification of hundreds to thousands of peptides in complex matrices such as plasma, accelerating discovery pipelines and supporting regulatory applications.
Objectives and Study Overview
This work presents a streamlined workflow for developing and validating large-scale parallel reaction monitoring (PRM) assays on the Thermo Scientific Stellar mass spectrometer. The study focuses on creating assays for a 500-peptide reference panel (PQ500) using optimized chromatographic gradients (60SPD and 100SPD) and evaluating analytical performance including reproducibility, linearity, limits of detection (LOD), and limits of quantification (LOQ).
Methodology
- Sample Preparation: Heavy PQ500 peptides spiked into digested plasma (300 ng/µl) with an 11-point serial dilution (100% to 0.005%) to assess analytical figures of merit.
- Data Processing: Skyline for spectral library construction and retention time alignment; PRM Conductor for automated selection and refinement of precursors and transitions.
Used Instrumentation
- Thermo Scientific Vanquish Neo UHPLC with EASY-Spray HPLC ES906A column (trap-and-elute, 45 °C).
- Thermo Scientific Stellar mass spectrometer operated in targeted MSn PRM mode (m/z 200–1500, HCD 30%, AGC standard).
- Skyline software with PRM Conductor external tool for method generation and optimization.
Main Results and Discussion
- Final assays comprised 1 622 precursors and ~13 800 transitions for both 60SPD and 100SPD methods.
- Reproducibility: Over 94% of peptides achieved CV < 20% across 10 plasma replicates.
- Linearity: Calibration curves displayed consistent responses across the 11-level dilution series; example peptide ELLDTVTAPQK demonstrated excellent fit.
- Analytical Sensitivity: LOQs below 50 attomoles for the majority of peptides (≈85% < 500 attomoles); LODs under 50 attomoles for nearly all targets.
- Gradient Comparison: 60SPD gradient outperformed 100SPD with on average 1.6× lower LOQs.
Benefits and Practical Applications
- Rapid assay creation within 3–4 days supports timely biomarker studies.
- Automated workflows increase consistency and reduce manual intervention.
- High sensitivity and specificity facilitate clinical proteomics and QA/QC in pharmaceutical development.
- Scalable platform accommodates large peptide panels for translational research.
Future Trends and Potential Applications
Emerging directions include integration with gas-phase fractionation DIA for seamless discovery-to-validation pipelines, incorporation of novel chromatographic modalities to boost throughput, and application of machine learning for real-time transition selection and method refinement in large-scale targeted assays.
Conclusion
The combination of the Stellar mass spectrometer, Skyline, and PRM Conductor delivers a robust, high-throughput solution for large-scale targeted proteomics. It achieves excellent sensitivity, reproducibility, and streamlined assay development, making it well suited for biomarker verification and translational studies.
References
- [1] PanoramaWeb. PRM Conductor external tool documentation. Thermo Fisher Scientific.
- [2] Remes PM, Jacob CC, Li Q, et al. Large-scale targeted PRM proteomics assays enabled by Stellar mass spectrometer. BioRxiv. 2024 Jun 1; doi:10.1101/2024.05.31.596848.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Revolutionizing translational research: large-scale targeted PRM proteomics assays enabled by the Stellar mass spectrometer
2024|Thermo Fisher Scientific|Posters
Poster # P-I-0174 Translational Research Revolutionizing translational research: large-scale targeted PRM proteomics assays enabled by the Stellar mass spectrometer Qingling Li, Cristina C. Jacob, Philip M. Remes, Jared Deyarmin, Stephanie Samra Thermo Fisher Scientific, San Jose, CA, USA, 95134 Introduction…
Key words
skyline, skylineprm, prmstellar, stellarconductor, conductorimport, importexport, exporttransition, transitionplasma, plasmaunscheduled, unscheduledpeptides, peptideslist, listwrong, wrongmethods, methodstransitions, transitionsgpf
Combining a new hybrid nominal mass platform and intelligent data acquisition to enable highly multiplexed targeted proteomics
2024|Thermo Fisher Scientific|Posters
Poster # P-I-0131 Combining a new hybrid nominal mass platform and intelligent data acquisition to enable highly multiplexed targeted proteomics Philip M. Remes1, Cristina C. Jacob1, Lilian R. Heil1, Nicholas Shulman2, Brendan X. MacLean2, Michael J. MacCoss2 1Thermo Fisher Scientific,…
Key words
stellar, stellaraltis, altistargeted, targetedprm, prmabsolute, absolutegpf, gpfdia, diaassays, assaysadaptive, adaptiveskyline, skylinenew, newpeptides, peptidespeptide, peptideplus, plusdilution
Evaluation of Parallel Reaction Monitoring assays at discovery scale on a new hybrid nominal mass instrument for phosphoproteomics studies
2024|Thermo Fisher Scientific|Posters
Evaluation of Parallel Reaction Monitoring assays at discovery scale on a new hybrid nominal mass instrument for phosphoproteomics studies Cristina C. Jacob1, Hasmik Keshishian2, Alan Atkins3, Philip M. Remes1, Michael W. Burgess2, Nikita Kormshchikov2, Claudia P.B. Martins1, and Steven A.…
Key words
conductor, conductorprm, prmphosphopeptides, phosphopeptidessil, siltfcgtpeylapevledndygr, tfcgtpeylapevledndygrrefinement, refinementstellar, stellarlight, lightgood, goodneo, neolntsdfqk, lntsdfqknnhqtelevprtpr, nnhqtelevprtprphosphosignatures, phosphosignaturesendogenous, endogenousrefines
Capture scheduled retention time window shift in large scale of peptide quantitation using a modified Orbitrap hybrid mass spectrometer
2025|Thermo Fisher Scientific|Posters
Capture scheduled retention time window shift in large scale of peptide quantitation using a modified Orbitrap hybrid mass spectrometer Qingling Li, Markus Kellmann, Jared Deyarmin, Stephanie Samra. Thermo Fisher Scientific, San Jose, CA Abstract Purpose: A high-throughput targeted method (~800…
Key words
adaptive, adaptivewindow, windowcaptured, capturedprm, prmorbitrap, orbitraptime, timeshifted, shiftedfile, filereference, referenceretention, retentionadjusted, adjustedexcedion, excedionscheduled, scheduledpeptides, peptideswindows