LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike

Revolutionizing translational research: large-scale targeted PRM proteomics assays enabled by the Stellar mass spectrometer

Posters | 2024 | Thermo Fisher Scientific | HUPOInstrumentation
LC/MS, LC/Orbitrap, LC/HRMS, LC/MS/MS
Industries
Proteomics
Manufacturer
Thermo Fisher Scientific

Summary

Importance of the topic


Recent advances in targeted proteomics enable high-throughput biomarker verification in clinical research at unprecedented scale.

Objectives and Study Overview


This work demonstrates a streamlined workflow using the Stellar MS, Skyline, and PRM Conductor to develop and validate large-scale PRM assays for hundreds of plasma proteins within 3–4 days.

Methodology and Instrumentation


Sample preparation: Biognosys PQ500 heavy reference peptides spiked into digested human plasma at 300 ng/µL, with an 11-point serial dilution series to assess LOD, LOQ, and linearity.
Liquid chromatography: Thermo Scientific Vanquish Neo UHPLC with EASY-Spray ES906A column, trap-and-elute injection, 45 °C, using 60 SPD (24 min) and 100 SPD (14 min) gradients.
Mass spectrometry: Thermo Scientific Stellar MS featuring high-resolution accurate mass linear ion traps, dynamic maximum injection times per target concurrency, Adaptive RT real-time chromatogram alignment, and PRM Conductor external tool within Skyline for automated method creation.

Main Results and Discussion


The transition list workflow generated scheduled PRM methods comprising 1 622 precursors and ~13 800 transitions for both 60 SPD and 100 SPD methods.
Performance metrics: 94 % of peptides achieved CV < 20 % (n = 10); LOQ for most peptides < 50 amol, LOD < 50 amol; the 60 SPD method yielded slightly lower LOD and LOQ than 100 SPD.
Automated filtering based on signal-to-noise, peak area, retention time, and transition consistency combined with adaptive scheduling ensured robust quantitation in plasma.

Benefits and Practical Applications


This platform offers enhanced sensitivity, specificity, and quantitative accuracy for highly multiplexed targeted proteomics, supporting large-scale biomarker verification and translational research in complex biological matrices.

Future Trends and Potential Applications


Integration of AI-driven method optimization, expanded peptide panels, multi-omics workflows, and clinical laboratory implementation is expected to further accelerate targeted proteomics applications.

Conclusion


The combination of Stellar MS, Skyline, and PRM Conductor delivers a rapid, scalable, and precise solution for large-scale PRM assays, facilitating translational biomarker studies with high sensitivity and reproducibility.

References


[1] PanoramaWeb. PRM Conductor resource. https://panoramaweb.org/prm_conductor.url
[2] Remes PM, Jacob CC, et al. bioRxiv Preprint 2024. doi:10.1101/2024.05.31.596848

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Revolutionizing translational research: large-scale targeted PRM proteomics assays enabled by Stellar mass spectrometer
Revolutionizing translational research: large-scale targeted PRM proteomics assays enabled by Stellar mass spectrometer Qingling Li, Cristina C. Jacob, Philip M. Remes, Jared Deyarmin, Stephanie Samra. Thermo Fisher Scientific, San Jose, CA, USA, 95134 Introduction Figure 2. LC gradients for 60SPD…
Key words
skyline, skylineprm, prmunscheduled, unscheduledconductor, conductorimport, importtransition, transitionexport, exportplasma, plasmastellar, stellarpeptides, peptidescreate, createmethods, methodswrong, wrongpeptide, peptidelists
Combining a new hybrid nominal mass platform and intelligent data acquisition to enable highly multiplexed targeted proteomics
Poster # P-I-0131 Combining a new hybrid nominal mass platform and intelligent data acquisition to enable highly multiplexed targeted proteomics Philip M. Remes1, Cristina C. Jacob1, Lilian R. Heil1, Nicholas Shulman2, Brendan X. MacLean2, Michael J. MacCoss2 1Thermo Fisher Scientific,…
Key words
stellar, stellaraltis, altistargeted, targetedprm, prmabsolute, absolutegpf, gpfdia, diaassays, assaysadaptive, adaptiveskyline, skylinenew, newpeptides, peptidespeptide, peptideplus, plusdilution
Capture scheduled retention time window shift in large scale of peptide quantitation using a modified Orbitrap hybrid mass spectrometer
Capture scheduled retention time window shift in large scale of peptide quantitation using a modified Orbitrap hybrid mass spectrometer Qingling Li, Markus Kellmann, Jared Deyarmin, Stephanie Samra. Thermo Fisher Scientific, San Jose, CA Abstract Purpose: A high-throughput targeted method (~800…
Key words
adaptive, adaptivewindow, windowcaptured, capturedprm, prmorbitrap, orbitraptime, timeshifted, shiftedfile, filereference, referenceretention, retentionadjusted, adjustedexcedion, excedionscheduled, scheduledpeptides, peptideswindows
Evaluation of Parallel Reaction Monitoring assays at discovery scale on a new hybrid nominal mass instrument for phosphoproteomics studies
Evaluation of Parallel Reaction Monitoring assays at discovery scale on a new hybrid nominal mass instrument for phosphoproteomics studies Cristina C. Jacob1, Hasmik Keshishian2, Alan Atkins3, Philip M. Remes1, Michael W. Burgess2, Nikita Kormshchikov2, Claudia P.B. Martins1, and Steven A.…
Key words
conductor, conductorprm, prmphosphopeptides, phosphopeptidessil, siltfcgtpeylapevledndygr, tfcgtpeylapevledndygrrefinement, refinementstellar, stellarlight, lightgood, goodneo, neolntsdfqk, lntsdfqknnhqtelevprtpr, nnhqtelevprtprphosphosignatures, phosphosignaturesendogenous, endogenousrefines
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike