Investigation of Separation Conditions and Prep Purification of GLP-1 Receptor Agonist Semaglutide

Applications | 2025 | ShimadzuInstrumentation
Software, MALDI, LC/MS, LC/TOF, HPLC
Industries
Pharma & Biopharma
Manufacturer
Shimadzu

Summary

Significance of the Topic


GLP-1 receptor agonists such as semaglutide play an important role in the treatment of type 2 diabetes and obesity. Achieving high-purity fractions quickly and reproducibly is critical for pharmaceutical development and manufacturing. Automation and AI-driven optimization streamline chromatographic method development, saving time and reducing expertise requirements.

Objectives and Study Overview


The study demonstrates an end-to-end workflow for preparative purification of semaglutide and its impurities by combining:
  • AI-based gradient optimization on analytical HPLC
  • Automated scale-up to semi-preparative LC
  • Rapid purity confirmation using MALDI-TOF MS

Methodology and Instrumentation


An AI algorithm in LabSolutions MD automatically refined multi-step gradient profiles to meet predefined resolution and elution time criteria for the target peak (semaglutide). Once optimal analytical conditions were found, the method-transfer feature scaled flow rate and column dimensions for preparative fractionation. Collected fractions were then assessed by MALDI-8030 TOF MS to confirm purity.

Used Instrumentation


  • LabSolutions MD software for automated gradient optimization and method transfer
  • Nexera XR analytical LC system with Shim-pack Scepter C18-120 column (4.6 × 150 mm, 5 µm)
  • Nexera Prep preparative LC system with Shim-pack Scepter C18-120 column (20 × 150 mm, 5 µm)
  • LCMS-2050 mass spectrometer for peak tracking by molecular weight
  • MALDI-8030 benchtop MALDI-TOF MS for rapid purity confirmation

Key Results and Discussion


Initial linear gradients failed to achieve resolution > 2.0 between semaglutide and adjacent impurities. After three AI-driven correction cycles, a multi-step gradient with isocratic holds met the resolution criterion (Rs = 8.0). Scaling up to 20 mL/min preparative flow preserved chromatographic performance, enabling efficient fraction collection. MALDI-TOF analysis of the collected fraction showed a single [M+H]+ peak at m/z 4114.5 with no co-eluting impurities, confirming high purity.

Benefits and Practical Applications


  • Significant time savings through AI-driven gradient optimization
  • Reduced manual effort in method development and scale-up
  • Reliable peak identification by molecular weight tracking
  • Rapid purity assessment by MALDI requiring only seconds per sample
  • Enhanced reproducibility and throughput in pharmaceutical workflows

Future Trends and Potential Applications


Further integration of AI analytics and advanced MS detection promises fully automated end-to-end workflows. Potential expansions include real-time feedback control, expanded automation for other peptide and protein therapeutics, and broader adoption in QA/QC environments for rapid batch release.

Conclusion


This investigation illustrates a seamless automated workflow for preparative purification of semaglutide, leveraging AI-guided HPLC optimization, method transfer to preparative scale, and MALDI-TOF confirmation. The approach accelerates method development, reduces human error, and ensures high-purity fractions for pharmaceutical R&D and production.

References


No formal literature citations were provided in the source document.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Automation and Efficiency Improvement Solutions (HPLC and LC-MS)
C190-E340 Automation and Efficiency Improvement Solutions (HPLC and LC-MS) HPLC/LC-MS Analysis Workflow Just as robots equipped with AI functionality are offering major changes to our lives, continuous advancements in Shimadzu HPLC, LC-MS, data analysis software, and pretreatment systems are significantly…
Key words
conditions, conditionsflp, flppreparative, preparativegradient, gradientautomatic, automaticoptimization, optimizationresolution, resolutionlabsolutions, labsolutionsmobile, mobilemin, minnexera, nexeraanalysis, analysisanalytical, analyticalautomatically, automaticallyphase
Automatic Optimization of Gradient Conditions by AI Algorithm Using Integrated LC System
High Performance Liquid Chromatograph Software for Efficient Method Development Application News Automatic Optimization of Gradient Conditions by AI Algorithm Using Integrated LC System Shinichi Fujisaki User Benefits  The AI algorithm of LabSolutionsTM MD can automatically optimize gradient conditions to…
Key words
gradient, gradientconditions, conditionsoptimization, optimizationautomatic, automaticalgorithm, algorithmcorrection, correctioncriteria, criteriainquiry, inquiryunresolved, unresolvedautomatically, automaticallyseven, sevenmolecule, moleculeexplored, exploredmeet, meetexplore
Automatic Optimization of Separation Conditions by AI Algorithm
Software for Efficient Method Development Ultra High Performance Liquid Chromatograph Application News Automatic Optimization of Separation Conditions by AI Algorithm -Optimization under Isocratic Elution- Shinichi Fujisaki User Benefits  The AI algorithm of LabSolutions MD can automatically optimize separation conditions,…
Key words
optimization, optimizationconditions, conditionsisocratic, isocraticautomatic, automaticseparation, separationcorrection, correctioninquiry, inquiryelution, elutionunder, underalgorithm, algorithmcondition, conditionsearch, searchinitial, initialoptimized, optimizedcriteria
Complete Analytical Workflows for GLP-1 Receptor Agonists
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction  Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsoxidation, oxidationliraglutide, liraglutidetirzepatide, tirzepatidemin, minmass, masssemaglutide, semaglutidetime, timeadvancebio, advancebioabundance, abundancehaegtftsdvssylegqaakefiawlvrgrg
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike