High-Sensitivity Analysis of Drugs in Ultra-Small Volumes Plasma Samples Using Micro-Flow LCMS/ MS
Posters | 2019 | ShimadzuInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerShimadzu
Key wordsverapamil, micro, nor, flow, microflow, plasma, mrm, sensitivity, implementation, signal, norverapamil, allowing, xenobiotics, mikros, rates, drugs, doses, rate, esi, method, quantification, performances, analytical, linear, time, pause, substituted, humans, affecting, standardization, accuracy, reasons, desirable, qual, substantial, source, proof, metabolism, concept, neat, area, effectiveness, entering, column, subsequently, std, quant, play, regression, body
Similar PDF
High-Sensitivity Analysis of Drugs in Ultra-Small Volume Plasma Samples Using Microflow LC/MS/MS
2020|Shimadzu|Applications
Application News No. Liquid Chromatography Mass Spectrometry High-Sensitivity Analysis of Drugs in Ultra-Small Volume Plasma Samples Using Microflow LC/MS/MS C213 It is known that drugs and other xenobiotics are generally subject to metabolism in the body, which facilitates their detoxification…
Key words
microflow, microflowverapamil, verapamilmikros, mikrossemi, seminor, nornexera, nexerapump, pumptrap, trapcolumn, columnsensitivity, sensitivityanalytical, analyticalconducted, conducteddrugs, drugsplasma, plasmainline
Shimadzu Microow Liquid Chromatography Mass Spectrometry System Nexera Mikros
2020|Shimadzu|Brochures and specifications
C146-E350B Microflow Liquid Chromatography Mass Spectrometry System Nexera Mikros M i c r o: Above and Beyond Nano T h e High Sensitivit y You E x p e c t from a Low Flow Sys tem with the Ruggedness…
Key words
mikros, mikrosmicroflow, microflownexera, nexerashim, shimbonded, bondedpack, packmicro, microplonas, plonasphase, phaseverapamil, verapamilpolar, polarsystem, systemdiameter, diameterpart, partmin
Microfow LC-MS/MS analysis of monoclonal antibody in human plasma at ng/mL level with nSMOL proteolysis
2018|Shimadzu|Posters
PO-CON1801E Microflow LC-MS/MS analysis of monoclonal antibody in human plasma at ng/mL level with nSMOL proteolysis. ASMS 2018 ThP-022 Kyoko Watanabe1 , Masateru Oguri1, Wataru Fukui1, Shinya Imamura1, Noriko Iwamoto2, Takashi Shimada2, Toshiya Matsubara1, Atsuhiko Toyama3, Kazuo Mukaibatake1, and Ichiro…
Key words
microflow, microflowantibody, antibodymonoclonal, monoclonalnsmol, nsmolplasma, plasmaassay, assayqualifier, qualifierantibodies, antibodiessensitivity, sensitivityalleviating, alleviatinglba, lbapeptide, peptidecdr, cdrpreclinical, preclinicaldead
Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
2020|Shimadzu|Posters
TP 473 Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS Tomoya Kudo, Wataru Fukui, and Toshiya Matsubara Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan 1. Overview H S Q G T F T In…
Key words
glucagon, glucagonaqdfvqwlmnt, aqdfvqwlmntmicroflow, microflowhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrhormones, hormonesmicro, microgrpp, grppkrnrnnia, krnrnniaoxyntomodulin, oxyntomodulinrslqdteeksrsfsasqadplsdpdqmnedkr, rslqdteeksrsfsasqadplsdpdqmnedkrsemi, semipeptide, peptidecondition, conditiontof, tofplasma