High-Sensitivity Analysis of Drugs in Ultra-Small Volumes Plasma Samples Using Micro-Flow LCMS/ MS

Posters | 2019 | ShimadzuInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Shimadzu

Summary

Importance of the Topic


Accurate quantification of drugs and metabolites in minute plasma volumes is vital for discovery-stage pharmacokinetic studies, especially when sample availability is limited by micro-sampling in small animal models. High-sensitivity analytical methods reduce animal usage, lower costs, and improve data quality for safety and efficacy assessments.

Objectives and Study Overview


This study demonstrates a proof-of-concept micro-flow LC–MS/MS method for quantifying the antiarrhythmic drug verapamil and its metabolite nor-verapamil in ultra-small plasma samples. The goals were to:
  • Develop a trap-and-elute micro-flow configuration to maximize sensitivity.
  • Evaluate signal enhancement versus semi-micro flow.
  • Assess recovery, accuracy, and precision using 2 µL plasma inputs.

Methodology and Instrumentation


The workflow combined micro-sampling and isotope-dilution MRM analysis:
  1. Sample Preparation:
    – 2 µL plasma spike with verapamil, nor-verapamil, and deuterated internal standard.
    – Dilution with acetonitrile/formic acid, centrifugation, and 5 µL injection.
  2. Chromatography:
    – Shimadzu Nexera MIKROS system with trap (Shim-pack MCT LC8) and analytical column (0.2×100 mm, 2.7 µm biphenyl).
    – Mobile phases water/formic acid and acetonitrile/formic acid.
    – Flow at 4 µL/min, 11 min total run time.
  3. Detection:
    – LCMS-8060 triple quadrupole with micro-ESI source.
    – MRM transitions for verapamil (455.0 > 150.25) and nor-verapamil (440.95 > 165).
    – Linear calibration 0.5–185 µg/L, 1/x weighting.

Key Results and Discussion


Signal intensity improved markedly compared to semi-micro flow:
  • Verapamil: >4.5-fold increase in peak area, >10-fold improvement in signal-to-noise.
  • Nor-verapamil: >3.5-fold increase in signal.
Recovery and matrix effects were evaluated at low QC (0.5 µg/L):
  • Overall recoveries >97% for both analytes.
  • Calibration accuracy between 85–115% across seven levels.

Benefits and Practical Applications


The micro-flow trap-and-elute approach offers:
  • High sensitivity without increasing injection volume.
  • Compatibility with ultra-small plasma samples (2 µL).
  • Potential integration with automated micro-sampling devices to adhere to 3R principles.

Future Trends and Applications


Emerging directions include applying micro-flow LC–MS/MS to:
  • High-throughput drug screening in early drug discovery.
  • Clinical microsampling for pediatric and neonatal studies.
  • Integration with novel sampling devices for minimally invasive monitoring.

Conclusion


The presented micro-flow LC–MS/MS method dramatically enhances sensitivity for verapamil and nor-verapamil quantification in ultra-small plasma volumes, enabling reduced sample requirements and supporting ethical micro-sampling strategies in pharmacokinetic research.

Reference


[1] Rapid Communications in Mass Spectrometry 2014, 28, 1293–1302

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
High-Sensitivity Analysis of Drugs in Ultra-Small Volume Plasma Samples Using Microflow LC/MS/MS
Application News No. Liquid Chromatography Mass Spectrometry High-Sensitivity Analysis of Drugs in Ultra-Small Volume Plasma Samples Using Microflow LC/MS/MS C213 It is known that drugs and other xenobiotics are generally subject to metabolism in the body, which facilitates their detoxification…
Key words
microflow, microflowverapamil, verapamilmikros, mikrossemi, seminor, nornexera, nexerapump, pumptrap, trapcolumn, columnsensitivity, sensitivityanalytical, analyticalconducted, conducteddrugs, drugsplasma, plasmainline
Shimadzu Microow Liquid Chromatography Mass Spectrometry System Nexera Mikros
C146-E350B Microflow Liquid Chromatography Mass Spectrometry System Nexera Mikros M i c r o: Above and Beyond Nano T h e High Sensitivit y You E x p e c t from a Low Flow Sys tem with the Ruggedness…
Key words
mikros, mikrosmicroflow, microflownexera, nexerashim, shimbonded, bondedmicro, micropack, packplonas, plonasphase, phaseverapamil, verapamilpolar, polarsystem, systempart, partmin, mindiameter
Microfow LC-MS/MS analysis of monoclonal antibody in human plasma at ng/mL level with nSMOL proteolysis
PO-CON1801E Microflow LC-MS/MS analysis of monoclonal antibody in human plasma at ng/mL level with nSMOL proteolysis. ASMS 2018 ThP-022 Kyoko Watanabe1 , Masateru Oguri1, Wataru Fukui1, Shinya Imamura1, Noriko Iwamoto2, Takashi Shimada2, Toshiya Matsubara1, Atsuhiko Toyama3, Kazuo Mukaibatake1, and Ichiro…
Key words
microflow, microflowantibody, antibodymonoclonal, monoclonalnsmol, nsmolplasma, plasmaassay, assayqualifier, qualifierantibodies, antibodiessensitivity, sensitivityalleviating, alleviatinglba, lbapeptide, peptidecdr, cdrspectrometric, spectrometricdead
Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
TP 473 Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS Tomoya Kudo, Wataru Fukui, and Toshiya Matsubara Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan 1. Overview H S Q G T F T In…
Key words
glucagon, glucagonaqdfvqwlmnt, aqdfvqwlmntmicroflow, microflowhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrhormones, hormonesgrpp, grppkrnrnnia, krnrnniaoxyntomodulin, oxyntomodulinrslqdteeksrsfsasqadplsdpdqmnedkr, rslqdteeksrsfsasqadplsdpdqmnedkrmicro, microsemi, semipeptide, peptidecondition, conditiontof, tofproglucagon
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike