Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
Posters | 2020 | ShimadzuInstrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesClinical Research
ManufacturerShimadzu
Key wordsglucagon, aqdfvqwlmnt, microflow, hsqgtftsdyskyldsrr, hormones, micro, grpp, krnrnnia, oxyntomodulin, rslqdteeksrsfsasqadplsdpdqmnedkr, semi, peptide, condition, tof, plasma, trap, proglucagon, off, using, lcms, cytokines, analytical, accuracy, hamper, homology, pancreas, peptides, llod, secretion, flow, gas, neb, mikros, mass, cocktail, grass, impaired, gut, evolute, rate, esi, protease, bioactive, hydrate, sensitive, quantification, curve, inhibitor, biotage, quantitation
Similar PDF
Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS
2016|Shimadzu|Posters
PO-CON1631E Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS ASMS 2016 ThP-494 Toshiya Matsubara1,2, Norihide Yokoi2, Ritsuko Hoshikawa2, Ichiro Hirano1, Susumu Seino2 Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan. 2 Kobe…
Key words
glucagon, glucagonhormones, hormonesplasma, plasmaaqdfvqwlmnt, aqdfvqwlmntpeptide, peptidefasting, fastingcasual, casualhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrrelated, relatedconventional, conventionalselective, selectivehuman, humansensitive, sensitivequantification, quantificationsecretion
ionkey/MS - APPLICATION COMPENDIUM
2016|Waters|Guides
[ ion key / MS ] APPLICATION COMPENDIUM Dear Colleague, The 2014 introduction of the ionKey/MS System was a turning point for LC-MS. The promise of increased levels of sensitivity from smaller sample sizes was finally a reality. We were…
Key words
ionkey, ionkeyikey, ikeyuplc, uplcsystem, systemplasma, plasmasensitivity, sensitivityion, ionhuman, humanusing, usingmobility, mobilityarea, areadevice, deviceseparation, separationassay, assayquantification
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinprotein, proteinuplc, uplcpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing
Shimadzu Microow Liquid Chromatography Mass Spectrometry System Nexera Mikros
2020|Shimadzu|Brochures and specifications
C146-E350B Microflow Liquid Chromatography Mass Spectrometry System Nexera Mikros M i c r o: Above and Beyond Nano T h e High Sensitivit y You E x p e c t from a Low Flow Sys tem with the Ruggedness…
Key words
mikros, mikrosmicroflow, microflownexera, nexerashim, shimbonded, bondedmicro, micropack, packplonas, plonasphase, phaseverapamil, verapamilpolar, polarsystem, systempart, partdiameter, diametermin