Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS

Posters | 2016 | ShimadzuInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
Industries
Clinical Research
Manufacturer
Shimadzu

Summary

Importance of the Topic



Glucagon and related peptides derived from proglucagon are key regulators of glucose metabolism and are implicated in the pathophysiology of diabetes and other metabolic disorders. Conventional immunoassays face cross-reactivity challenges when measuring closely related peptide hormones. A robust, selective, and sensitive LC/MS/MS approach addresses these limitations and provides accurate quantification of glucagon and its analogues in human plasma.

Goals and Study Overview



This study aimed to develop and validate a conventional flow LC/MS/MS method for the simultaneous quantification of intact glucagon, GLP-1 isoforms, insulin, and therapeutic GLP-1 analogues in human plasma. The key objectives were to achieve low picomolar detection limits, resolve structurally similar peptides, and demonstrate applicability to endogenous samples.

Methodology and Instrumentation



Sample Preparation
  • Human plasma (500 µL) collected with protease inhibitors
  • Acidification with 40% acetic acid followed by alkalization with ammonium hydroxide
  • SPE cleanup using EVOLUTE EXPRESS AX cartridges
  • Elution with acetonitrile water acetic acid mixture and dilution prior to analysis
LC/MS/MS Setup
  • Shimadzu Nexera X2 UHPLC with Shim-Pack ODS II or Phenomenex Kinetex C18 columns (2.0–2.1 mm × 100–150 mm)
  • Binary gradient of 0.1% formic acid in water and acetonitrile
  • Shimadzu LCMS-8060 triple quadrupole mass spectrometer with ESI positive mode
  • MRM transitions optimized for each peptide charge state (3+ to 6+)

Main Results and Discussion



The method achieved baseline separation of intact hormones and analogues within 10–13 minutes. Calibration curves for glucagon and insulin showed linearity over four orders of magnitude (r2 > 0.9989). The lower limit of detection for glucagon was 2.5 pM, well below physiological levels (10–50 pM). Recovery experiments in spiked plasma yielded accuracies near 100%. Analysis of healthy volunteer samples revealed a twofold increase in fasting versus casual glucagon levels, consistent with physiological expectations.

Benefits and Practical Applications



This LC/MS/MS protocol offers highly selective quantification of proglucagon-derived peptides without antibody cross-reactivity. Practical applications include:
  • Clinical research on diabetes and metabolic syndrome
  • Therapeutic monitoring of GLP-1 analogues
  • Pharmacokinetic and pharmacodynamic studies
  • Quality control in peptide drug development

Future Trends and Potential Uses



Advances may focus on multiplexed panels of peptide hormones, microflow LC for higher throughput, integration with automated sample preparation systems, and extension to novel biomarkers. Coupling with high-resolution MS or ion mobility could further enhance selectivity and expand the method to complex clinical matrices.

Conclusion



The developed conventional flow LC/MS/MS approach enables reliable, sensitive, and selective quantification of glucagon and related peptide hormones in human plasma. The method overcomes immunoassay limitations, demonstrates robust performance in endogenous samples, and offers broad utility for clinical and pharmaceutical research.

Reference(s)


  • Matsubara T, Yokoi N, Hoshikawa R, Hirano I, Seino S. Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS. ASMS 2016; ThP-494.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
TP 473 Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS Tomoya Kudo, Wataru Fukui, and Toshiya Matsubara Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan 1. Overview H S Q G T F T In…
Key words
glucagon, glucagonaqdfvqwlmnt, aqdfvqwlmntmicroflow, microflowhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrhormones, hormonesgrpp, grppkrnrnnia, krnrnniaoxyntomodulin, oxyntomodulinrslqdteeksrsfsasqadplsdpdqmnedkr, rslqdteeksrsfsasqadplsdpdqmnedkrmicro, microsemi, semipeptide, peptidecondition, conditiontof, toftrap
PEPTIDE AND PROTEIN BIOANALYSIS
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinuplc, uplcprotein, proteinmrm, mrmproteinworks, proteinworkspeptides, peptidesantibody, antibodyusing
ionkey/MS - APPLICATION COMPENDIUM
[ ion key / MS ] APPLICATION COMPENDIUM Dear Colleague, The 2014 introduction of the ionKey/MS System was a turning point for LC-MS. The promise of increased levels of sensitivity from smaller sample sizes was finally a reality. We were…
Key words
ionkey, ionkeyikey, ikeyuplc, uplcsystem, systemplasma, plasmasensitivity, sensitivityion, ionhuman, humanusing, usingmobility, mobilityarea, areaseparation, separationassay, assaydevice, devicequantification
Development of bioanalytical method for determination of intact human insulin from plasma using LC/MS/MS
PO-CON1747E Development of bioanalytical method for determination of intact human insulin from plasma using LC/MS/MS ASMS 2017 WP 659 Deepti Bhandarkar1, Ashutosh Shelar1, Vikas Trivedi2, Tulsidas Mishra2, Abhishek Gandhi2, Swati Guttikar2 and Toshiya Matsubara3 1 Shimadzu Analytical (India) Pvt. Ltd.,…
Key words
insulin, insulinstripped, strippedhuman, humanplasma, plasmaintact, intactbioanalytical, bioanalyticalcharcoal, charcoaldevelopment, developmentusing, usingdetermination, determinationfrom, frommethod, methodheterodimer, heterodimerquantitation, quantitationtemperature
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike