Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS
Posters | 2016 | ShimadzuInstrumentation
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerShimadzu
Key wordsglucagon, hormones, plasma, aqdfvqwlmnt, fasting, peptide, casual, hsqgtftsdyskyldsrr, related, conventional, selective, human, sensitive, quantification, insulin, secretion, cocktail, endogenous, protease, krnrnnia, rslqdteeksrsfsasqadplsdpdqmnedkr, using, healthy, mrm, volunteer, blood, area, curve, inhibitor, hormone, mini, mobile, mpgf, tube, protein, min, grpp, oxyntomodulin, containing, cid, chromatogram, phase, cytokines, amino, level, homology, pancreas, peptides, llod, flow
Similar PDF
Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
2020|Shimadzu|Posters
TP 473 Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS Tomoya Kudo, Wataru Fukui, and Toshiya Matsubara Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan 1. Overview H S Q G T F T In…
Key words
glucagon, glucagonaqdfvqwlmnt, aqdfvqwlmntmicroflow, microflowhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrhormones, hormonesgrpp, grppkrnrnnia, krnrnniaoxyntomodulin, oxyntomodulinrslqdteeksrsfsasqadplsdpdqmnedkr, rslqdteeksrsfsasqadplsdpdqmnedkrmicro, microsemi, semipeptide, peptidecondition, conditiontof, tofplasma
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinprotein, proteinuplc, uplcpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing
ionkey/MS - APPLICATION COMPENDIUM
2016|Waters|Guides
[ ion key / MS ] APPLICATION COMPENDIUM Dear Colleague, The 2014 introduction of the ionKey/MS System was a turning point for LC-MS. The promise of increased levels of sensitivity from smaller sample sizes was finally a reality. We were…
Key words
ionkey, ionkeyikey, ikeyuplc, uplcsystem, systemplasma, plasmasensitivity, sensitivityion, ionhuman, humanusing, usingmobility, mobilityarea, areaassay, assaydevice, deviceseparation, separationquantification
Development of bioanalytical method for determination of intact human insulin from plasma using LC/MS/MS
2017|Shimadzu|Posters
PO-CON1747E Development of bioanalytical method for determination of intact human insulin from plasma using LC/MS/MS ASMS 2017 WP 659 Deepti Bhandarkar1, Ashutosh Shelar1, Vikas Trivedi2, Tulsidas Mishra2, Abhishek Gandhi2, Swati Guttikar2 and Toshiya Matsubara3 1 Shimadzu Analytical (India) Pvt. Ltd.,…
Key words
insulin, insulinhuman, humanstripped, strippedplasma, plasmaintact, intactbioanalytical, bioanalyticalcharcoal, charcoaldevelopment, developmentusing, usingdetermination, determinationfrom, frommethod, methodheterodimer, heterodimerquantitation, quantitationtemperature