Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS
Posters | 2016 | ShimadzuInstrumentation
Glucagon and related peptides derived from proglucagon are key regulators of glucose metabolism and are implicated in the pathophysiology of diabetes and other metabolic disorders. Conventional immunoassays face cross-reactivity challenges when measuring closely related peptide hormones. A robust, selective, and sensitive LC/MS/MS approach addresses these limitations and provides accurate quantification of glucagon and its analogues in human plasma.
This study aimed to develop and validate a conventional flow LC/MS/MS method for the simultaneous quantification of intact glucagon, GLP-1 isoforms, insulin, and therapeutic GLP-1 analogues in human plasma. The key objectives were to achieve low picomolar detection limits, resolve structurally similar peptides, and demonstrate applicability to endogenous samples.
Sample Preparation
The method achieved baseline separation of intact hormones and analogues within 10–13 minutes. Calibration curves for glucagon and insulin showed linearity over four orders of magnitude (r2 > 0.9989). The lower limit of detection for glucagon was 2.5 pM, well below physiological levels (10–50 pM). Recovery experiments in spiked plasma yielded accuracies near 100%. Analysis of healthy volunteer samples revealed a twofold increase in fasting versus casual glucagon levels, consistent with physiological expectations.
This LC/MS/MS protocol offers highly selective quantification of proglucagon-derived peptides without antibody cross-reactivity. Practical applications include:
Advances may focus on multiplexed panels of peptide hormones, microflow LC for higher throughput, integration with automated sample preparation systems, and extension to novel biomarkers. Coupling with high-resolution MS or ion mobility could further enhance selectivity and expand the method to complex clinical matrices.
The developed conventional flow LC/MS/MS approach enables reliable, sensitive, and selective quantification of glucagon and related peptide hormones in human plasma. The method overcomes immunoassay limitations, demonstrates robust performance in endogenous samples, and offers broad utility for clinical and pharmaceutical research.
LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerShimadzu
Summary
Importance of the Topic
Glucagon and related peptides derived from proglucagon are key regulators of glucose metabolism and are implicated in the pathophysiology of diabetes and other metabolic disorders. Conventional immunoassays face cross-reactivity challenges when measuring closely related peptide hormones. A robust, selective, and sensitive LC/MS/MS approach addresses these limitations and provides accurate quantification of glucagon and its analogues in human plasma.
Goals and Study Overview
This study aimed to develop and validate a conventional flow LC/MS/MS method for the simultaneous quantification of intact glucagon, GLP-1 isoforms, insulin, and therapeutic GLP-1 analogues in human plasma. The key objectives were to achieve low picomolar detection limits, resolve structurally similar peptides, and demonstrate applicability to endogenous samples.
Methodology and Instrumentation
Sample Preparation
- Human plasma (500 µL) collected with protease inhibitors
- Acidification with 40% acetic acid followed by alkalization with ammonium hydroxide
- SPE cleanup using EVOLUTE EXPRESS AX cartridges
- Elution with acetonitrile water acetic acid mixture and dilution prior to analysis
- Shimadzu Nexera X2 UHPLC with Shim-Pack ODS II or Phenomenex Kinetex C18 columns (2.0–2.1 mm × 100–150 mm)
- Binary gradient of 0.1% formic acid in water and acetonitrile
- Shimadzu LCMS-8060 triple quadrupole mass spectrometer with ESI positive mode
- MRM transitions optimized for each peptide charge state (3+ to 6+)
Main Results and Discussion
The method achieved baseline separation of intact hormones and analogues within 10–13 minutes. Calibration curves for glucagon and insulin showed linearity over four orders of magnitude (r2 > 0.9989). The lower limit of detection for glucagon was 2.5 pM, well below physiological levels (10–50 pM). Recovery experiments in spiked plasma yielded accuracies near 100%. Analysis of healthy volunteer samples revealed a twofold increase in fasting versus casual glucagon levels, consistent with physiological expectations.
Benefits and Practical Applications
This LC/MS/MS protocol offers highly selective quantification of proglucagon-derived peptides without antibody cross-reactivity. Practical applications include:
- Clinical research on diabetes and metabolic syndrome
- Therapeutic monitoring of GLP-1 analogues
- Pharmacokinetic and pharmacodynamic studies
- Quality control in peptide drug development
Future Trends and Potential Uses
Advances may focus on multiplexed panels of peptide hormones, microflow LC for higher throughput, integration with automated sample preparation systems, and extension to novel biomarkers. Coupling with high-resolution MS or ion mobility could further enhance selectivity and expand the method to complex clinical matrices.
Conclusion
The developed conventional flow LC/MS/MS approach enables reliable, sensitive, and selective quantification of glucagon and related peptide hormones in human plasma. The method overcomes immunoassay limitations, demonstrates robust performance in endogenous samples, and offers broad utility for clinical and pharmaceutical research.
Reference(s)
- Matsubara T, Yokoi N, Hoshikawa R, Hirano I, Seino S. Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS. ASMS 2016; ThP-494.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
2020|Shimadzu|Posters
TP 473 Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS Tomoya Kudo, Wataru Fukui, and Toshiya Matsubara Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan 1. Overview H S Q G T F T In…
Key words
glucagon, glucagonaqdfvqwlmnt, aqdfvqwlmntmicroflow, microflowhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrhormones, hormonesgrpp, grppkrnrnnia, krnrnniaoxyntomodulin, oxyntomodulinrslqdteeksrsfsasqadplsdpdqmnedkr, rslqdteeksrsfsasqadplsdpdqmnedkrmicro, microsemi, semipeptide, peptidecondition, conditiontof, toftrap
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Guides
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Key words
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinuplc, uplcprotein, proteinmrm, mrmproteinworks, proteinworkspeptides, peptidesantibody, antibodyusing
ionkey/MS - APPLICATION COMPENDIUM
2016|Waters|Guides
[ ion key / MS ] APPLICATION COMPENDIUM Dear Colleague, The 2014 introduction of the ionKey/MS System was a turning point for LC-MS. The promise of increased levels of sensitivity from smaller sample sizes was finally a reality. We were…
Key words
ionkey, ionkeyikey, ikeyuplc, uplcsystem, systemplasma, plasmasensitivity, sensitivityion, ionhuman, humanusing, usingmobility, mobilityarea, areaseparation, separationassay, assaydevice, devicequantification
Workflows for GLP-1 Receptor Agonists and Therapeutic Peptides: Identity, Impurity, Bioanalysis, and Stability Testing
2026|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Workflows for GLP-1 Receptor Agonists and Therapeutic Peptides: Identity, Impurity, Bioanalysis, and Stability Testing Contents Raw Material Purity and Impurity Identification Analysis Bioanalysis Stability Testing Studies Contents Introduction 02 1 Raw Material Identification 03 1.1 Verification…
Key words
bioanalysis, bioanalysisimpurity, impurityraw, rawstudies, studiespurity, puritycontents, contentsstability, stabilitytesting, testingmaterial, materialidentification, identificationexenatide, exenatidetirzepatide, tirzepatidesemaglutide, semaglutidepeptide, peptideliraglutide