Agilent 6560 Ion Mobility Q-TOF LC/MS System
Brochures and specifications | 2017 | Agilent TechnologiesInstrumentation
Ion Mobility, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
IndustriesManufacturerAgilent Technologies
Key wordsdrift, ion, mobility, funnel, separation, region, ccs, charge, analysisanalysis, panomics, you, protein, peptides, extracted, empirical, mass, dimension, data, effectively, agilent, glycomics, cross, melezitose, molecular, conformations, molecules, imagine, raffinose, difference, detect, orthogonal, dense, capacity, proteomics, mapping, collision, matters, conformational, resolve, individual, pan, conformation, research, you’re, tool, time, all, ions, lipidomics, omics
Similar PDF
Agilent 6560 Ion Mobility LC/Q-TOF
2023|Agilent Technologies|Brochures and specifications
Add a New Dimension to Your Research Agilent 6560 Ion Mobility LC/Q-TOF Reveal More Details Than Ever Before Does your research involve characterizing small molecules or proteins, increasing metabolite coverage maps, or ensuring food safety? The Agilent 6560 Ion Mobility…
Key words
ccs, ccscollision, collisionvoltage, voltagedrift, driftregion, regionisomers, isomersciu, ciustructural, structuralcharge, chargeextracted, extractedmobility, mobilitydtims, dtimsglycomics, glycomicsmass, massion
ADD A NEW DIMENSION TO YOUR RESEARCH WITH THE AGILENT 6560 ION MOBILITY Q-TOF LC/MS
2015|Agilent Technologies|Technical notes
ADD A NEW DIMENSION TO YOUR RESEARCH WITH THE AGILENT 6560 ION MOBILITY Q-TOF LC/MS The Measure of Confidence Ken Imatani Agilent Q-TOF LC/MS Product Manager David Wong, Ph.D. Senior Application Scientist Applications Highlights The Agilent 6560 Ion Mobility Q-TOF…
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF Mass Spectrometer System Technical Overview Authors Ruwan Kurulugama, Ken Imatani, and The Agilent Ion Mobility Q-TOF Mass Spectrometer System Lester Taylor • Delivers an added dimension of separation Agilent Technologies, Inc. • Provides direct measurement…
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelseparation, separationcross, crossfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry
2019|Agilent Technologies|Applications
Application Note Biologics Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry Authors Rebecca S. Glaskin, Caroline S. Chu, and Dawn M. Stickle Agilent Technologies, Inc. Abstract This application note describes an automated workflow for the analysis…
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikccs, ccsfqseeqqqtedelqdk, fqseeqqqtedelqdkcharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masspeptides, peptidessequence, sequenceekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperrspypsrsr