Agilent 6560 Ion Mobility Q-TOF LC/MS System | LabRulez LCMS_EN
 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftdiesel, dieselmobility, mobilitydefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundsims, imstof
 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftdiesel, dieselmobility, mobilitydefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundsims, imstof
 

Related content

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Applications
| 2022 | Shimadzu
Instrumentation
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Posters
| 2022 | Waters
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Waters
Industries
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Applications
| 2022 | Shimadzu
Instrumentation
Ion chromatography
Manufacturer
Shimadzu
Industries
Environmental
 

Related content

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
HPLC
Manufacturer
Thermo Fischer Scientific
Industries
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Applications
| 2022 | Shimadzu
Instrumentation
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Food & Agriculture

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Posters
| 2022 | Waters
Instrumentation
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Waters
Industries
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Applications
| 2022 | Shimadzu
Instrumentation
Ion chromatography
Manufacturer
Shimadzu
Industries
Environmental
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.