Agilent 6560 Ion Mobility Q-TOF LC/MS System | LabRulez LCMS
 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftdiesel, dieselmobility, mobilitydefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundstof, tofims
 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftdiesel, dieselmobility, mobilitydefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundstof, tofims
 

Related content

Routine Determination of Trifluoroacetic Acid (TFA) and Difluoroacetic Acid (DFA) in Surface and Drinking Water by Direct Injection Using UPLC-MS/MS

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Environmental

Analysis of Multiclass Steroids in Serum Using Agilent Ultivo Triple Quadrupole LC/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Clinical Research

Efficient Method Development on Pharmaceutical Impurities Using Single Quadrupole Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

Identification of plastic additives in pharmaceutical packaging using a fully automated parallel extraction evaporator system and UHPLC-HRMS

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
Sample Preparation, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

How to prolong the lifetime of your HPLC column

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
Consumables, LC columns
Manufacturer
Thermo Fischer Scientific
Industries
---
 

Related content

Routine Determination of Trifluoroacetic Acid (TFA) and Difluoroacetic Acid (DFA) in Surface and Drinking Water by Direct Injection Using UPLC-MS/MS

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Environmental

Analysis of Multiclass Steroids in Serum Using Agilent Ultivo Triple Quadrupole LC/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Clinical Research

Efficient Method Development on Pharmaceutical Impurities Using Single Quadrupole Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

Identification of plastic additives in pharmaceutical packaging using a fully automated parallel extraction evaporator system and UHPLC-HRMS

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
Sample Preparation, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

How to prolong the lifetime of your HPLC column

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
Consumables, LC columns
Manufacturer
Thermo Fischer Scientific
Industries
---
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.