Agilent 6560 Ion Mobility Q-TOF LC/MS SystemBrochures and specifications | 2017 | Agilent TechnologiesInstrumentation
Ion Mobility, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Agilent Technologies
Key words

 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikccs, ccsfqseeqqqtedelqdk, fqseeqqqtedelqdkphosphorylation, phosphorylationcharge, chargenavpitptlnreqlstseenskk, navpitptlnreqlstseenskksequence, sequencepeptides, peptidesmass, massphosphopeptides, phosphopeptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeuniform, uniformagilent, agilentsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcharge, chargecounts, countsmobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftmobility, mobilitydiesel, dieseldefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundsims, imstof

Agilent 6560 Ion Mobility Q-TOF LC/MS SystemBrochures and specifications | 2017 | Agilent TechnologiesInstrumentation
Ion Mobility, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Manufacturer
Agilent Technologies
Key words

 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikccs, ccsfqseeqqqtedelqdk, fqseeqqqtedelqdkphosphorylation, phosphorylationcharge, chargenavpitptlnreqlstseenskk, navpitptlnreqlstseenskksequence, sequencepeptides, peptidesmass, massphosphopeptides, phosphopeptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeuniform, uniformagilent, agilentsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcharge, chargecounts, countsmobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftmobility, mobilitydiesel, dieseldefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundsims, imstof
 

Related content

Waters Atlantis Premier BEH Z-HILIC Columns

Brochures and specifications
| 2021 | Waters
Instrumentation
Consumables, LC columns
Manufacturer
Waters
Industries
---

Simultaneous Quantification of Multiclass PFAS in Biosolids Using a Single Extraction Method and the Agilent 6495 Triple Quadrupole LC/MS

Applications
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

Quantitative Determination of NDMA Impurity in Ranitidine Drug Products – Examples of Actual Samples Analysis by LCMS-8060 with APCI

Applications
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

It’s Not All About the Column: The Role of the Mobile Phase and Your Instrument

Presentations
| 2021 | Agilent Technologies
Instrumentation
Consumables, HPLC
Manufacturer
Agilent Technologies
Industries
---

Improved Separation of RNA Nucleotides, Nucleosides, and Nucleobases on Atlantis Premier BEH Z-HILIC Columns

Applications
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research
 

Related content

Waters Atlantis Premier BEH Z-HILIC Columns

Brochures and specifications
| 2021 | Waters
Instrumentation
Consumables, LC columns
Manufacturer
Waters
Industries
---

Simultaneous Quantification of Multiclass PFAS in Biosolids Using a Single Extraction Method and the Agilent 6495 Triple Quadrupole LC/MS

Applications
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

Quantitative Determination of NDMA Impurity in Ranitidine Drug Products – Examples of Actual Samples Analysis by LCMS-8060 with APCI

Applications
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

It’s Not All About the Column: The Role of the Mobile Phase and Your Instrument

Presentations
| 2021 | Agilent Technologies
Instrumentation
Consumables, HPLC
Manufacturer
Agilent Technologies
Industries
---

Improved Separation of RNA Nucleotides, Nucleosides, and Nucleobases on Atlantis Premier BEH Z-HILIC Columns

Applications
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.