Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikccs, ccsfqseeqqqtedelqdk, fqseeqqqtedelqdkphosphorylation, phosphorylationcharge, chargenavpitptlnreqlstseenskk, navpitptlnreqlstseenskksequence, sequencepeptides, peptidesmass, massphosphopeptides, phosphopeptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeuniform, uniformagilent, agilentsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcharge, chargecounts, countsmobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftmobility, mobilitydiesel, dieselion, iondefect, defectsulfur, sulfurapci, apcidibenzothiophenes, dibenzothiophenesfunnel, funnelseries, seriescompounds, compoundsims, imstof
 

Similar PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Key words
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikccs, ccsfqseeqqqtedelqdk, fqseeqqqtedelqdkphosphorylation, phosphorylationcharge, chargenavpitptlnreqlstseenskk, navpitptlnreqlstseenskksequence, sequencepeptides, peptidesmass, massphosphopeptides, phosphopeptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technical notes
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Key words
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeuniform, uniformagilent, agilentsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Key words
drift, driftcharge, chargecounts, countsmobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Applications
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Key words
kendrick, kendrickmass, massdrift, driftmobility, mobilitydiesel, dieselion, iondefect, defectsulfur, sulfurapci, apcidibenzothiophenes, dibenzothiophenesfunnel, funnelseries, seriescompounds, compoundsims, imstof
 

Related content

Evaluating the Waters ACQUITY Premier System as a Flexible LC Platform That Can Be Broadly Deployed in Biopharmaceutical Labs

Applications
| 2021 | Waters
Instrumentation
HPLC, GPC/SEC
Manufacturer
Waters
Industries
Pharma & Biopharma

Analysis of 510 Pesticide Residues in Honey and Onion on an Agilent 6470 Triple Quadrupole LC/MS System

Applications
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Food & Agriculture

Rapid Detection of Illicit Drugs and Psychoactive Plant Component by Green Technology DPiMSTM-8060

Applications
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ, DART
Manufacturer
Shimadzu
Industries
Forensics
 

Related content

Evaluating the Waters ACQUITY Premier System as a Flexible LC Platform That Can Be Broadly Deployed in Biopharmaceutical Labs

Applications
| 2021 | Waters
Instrumentation
HPLC, GPC/SEC
Manufacturer
Waters
Industries
Pharma & Biopharma

Analysis of 510 Pesticide Residues in Honey and Onion on an Agilent 6470 Triple Quadrupole LC/MS System

Applications
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Food & Agriculture

Rapid Detection of Illicit Drugs and Psychoactive Plant Component by Green Technology DPiMSTM-8060

Applications
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ, DART
Manufacturer
Shimadzu
Industries
Forensics
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.