SPATIAL MAPPING OF ION DISTRIBUTIONS IN PNEUMATICALLY ASSISTED ELECTROSPRAYS
Posters | 2019 | WatersInstrumentation
The spatial distribution of ions produced by pneumatically assisted electrospray sources directly influences sensitivity, reproducibility and quantitative performance in liquid chromatography–mass spectrometry (LC–MS). Fine control of emitter placement, gas flows and voltages is critical for reliable analysis in proteomics, metabolomics and industrial QC applications. Mapping ion yields in three dimensions provides insight into fundamental ion‐generation mechanisms and guides source optimization for improved robustness.
This work aimed to characterize how emitter position relative to the MS inlet and cone affects ion intensity, charge state distributions, adduct formation and in‐source fragmentation under typical high‐flow (650 µL/min) LC–MS conditions. Using automated x–y–z translation, spatial ion‐intensity maps were generated for model peptides angiotensin I and leucine enkephalin across varied cone voltages.
The experimental platform comprised a Waters Acquity UPLC I‐Class delivering angiotensin I or leucine enkephalin solutions at 650 µL/min. A stepper‐motor‐driven emitter mount positioned the spray in a 3D grid. Key parameters included:
Data acquisition used MassLynx, while raw files were converted to mzML and processed in R to extract ion intensities ([M+H]+, [M+Na]+ etc.). Imaging involved spline interpolation in x, y and z to visualize spatial variations.
Spatial maps revealed that:
These findings highlight that both electric field geometry and droplet‐surface interactions contribute to ion formation and fragmentation.
Optimizing emitter placement can:
Such improvements benefit high‐throughput LC–MS in pharmaceutical QC, biomarker discovery and environmental analysis.
Advances may include dynamic emitter repositioning for real‐time sensitivity tuning, integration of imaging feedback to auto‐correct misalignment, and the application of machine‐learning models to predict optimal source configurations. Further exploration of alternative pneumatically assisted spray designs could yield sources with inherently reduced positional dependence.
This study demonstrates that detailed spatial mapping of ion distributions in pneumatically assisted electrospray reveals complex dependencies on emitter position and source parameters. By identifying optimal geometries, users can significantly improve LC–MS sensitivity, reproducibility and method stability.
LC/MS
IndustriesManufacturerWaters
Summary
Importance of the Topic
The spatial distribution of ions produced by pneumatically assisted electrospray sources directly influences sensitivity, reproducibility and quantitative performance in liquid chromatography–mass spectrometry (LC–MS). Fine control of emitter placement, gas flows and voltages is critical for reliable analysis in proteomics, metabolomics and industrial QC applications. Mapping ion yields in three dimensions provides insight into fundamental ion‐generation mechanisms and guides source optimization for improved robustness.
Study Objectives and Overview
This work aimed to characterize how emitter position relative to the MS inlet and cone affects ion intensity, charge state distributions, adduct formation and in‐source fragmentation under typical high‐flow (650 µL/min) LC–MS conditions. Using automated x–y–z translation, spatial ion‐intensity maps were generated for model peptides angiotensin I and leucine enkephalin across varied cone voltages.
Methodology and Instrumentation
The experimental platform comprised a Waters Acquity UPLC I‐Class delivering angiotensin I or leucine enkephalin solutions at 650 µL/min. A stepper‐motor‐driven emitter mount positioned the spray in a 3D grid. Key parameters included:
- ESI capillary voltage: 800 V
- Desolvation gas flow: 16 L/min at 120 °C
- Nebulizer gas flow: 1.5 L/min
- Cone voltage: 5–79 V
- Gas heater temperature: 600 °C
Data acquisition used MassLynx, while raw files were converted to mzML and processed in R to extract ion intensities ([M+H]+, [M+Na]+ etc.). Imaging involved spline interpolation in x, y and z to visualize spatial variations.
Main Results and Discussion
Spatial maps revealed that:
- Maximum total ion signal occurs when the spray plume is directed onto the sampling cone at an optimal distance along the z-axis.
- Charge state ratios for angiotensin I vary strongly with x-position near the cone, with higher multiply charged ions observed when spraying directly on the cone surface.
- Leucine enkephalin [M+Na]+ adduct abundance showed distinct spatial dependence, whereas the a4/b4 fragment ratio remained largely position‐independent.
- Maintaining an intermediate distance in x reduces sensitivity to emitter position, balancing ion production and desolvation time.
These findings highlight that both electric field geometry and droplet‐surface interactions contribute to ion formation and fragmentation.
Benefits and Practical Applications
Optimizing emitter placement can:
- Enhance method robustness by reducing sensitivity to slight misalignments.
- Improve reproducibility in non‐targeted profiling by stabilizing charge state distributions.
- Increase overall sensitivity without raising source fragmentation.
Such improvements benefit high‐throughput LC–MS in pharmaceutical QC, biomarker discovery and environmental analysis.
Future Trends and Opportunities
Advances may include dynamic emitter repositioning for real‐time sensitivity tuning, integration of imaging feedback to auto‐correct misalignment, and the application of machine‐learning models to predict optimal source configurations. Further exploration of alternative pneumatically assisted spray designs could yield sources with inherently reduced positional dependence.
Conclusion
This study demonstrates that detailed spatial mapping of ion distributions in pneumatically assisted electrospray reveals complex dependencies on emitter position and source parameters. By identifying optimal geometries, users can significantly improve LC–MS sensitivity, reproducibility and method stability.
Reference
- Thibault P., Alexander A.J., Boyd R.K., Tomer K.B. Delayed Dissociation Spectra of Survivor Ions from High‐Energy Collisional Activation. J. Am. Soc. Mass Spectrom. 1993, 4, 845.
- Hirabayashi A., Sakairi M., Takada Y. Evaporation of Charged Droplets in Atmospheric Pressure Spray Mass Spectrometry. J. Mass Spectrom. Soc. Jpn. 1993, 41, 287.
- Hirabayashi A., Sakairi M., Koizumi H. Sonic Spray Ionization Method for Atmospheric Pressure Ionization Mass Spectrometry. Anal. Chem. 1994, 66, 4557.
- Cristoni S., Bernardi L.R., Biunno I., Tubaro M., Guidugli F. Surface‐Activated No‐Discharge Atmospheric Pressure Chemical Ionization. Rapid Commun. Mass Spectrom. 2003, 17, 1973.
- Bajic S. U.S. Patent No. 8,809,777. U.S. Patent and Trademark Office, Washington, DC (2014).
- Lubin A., Bajic S., Cabooter D., Augustijns P., Cuyckens F. Atmospheric Pressure Ionization Using a High Voltage Target Compared to Electrospray Ionization. J. Mass Spectrom. 2017, 28, 286.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Experimental characterization of automated emitter position optimization strategies for a new low-flow ion source and cartridge
2025|Thermo Fisher Scientific|Posters
Experimental characterization of automated emitter position optimization strategies for a new low-flow ion source and cartridge Joshua A. Silveira, Katherine L. Walker, Matt Tsai, Gary A. Schultz*, Cornelia L. Boeser, Jeff Op de Beeck, Runsheng Zheng, Eloy R. Wouters, Thermo…
Key words
emitter, emitterdiagonal, diagonalunfiltered, unfilteredfaims, faimsposition, positionpeptides, peptidesgroups, groupsµpac, µpacorifice, orificeprotein, proteinpulled, pulledmin, minmedian, medianautomated, automatedgradient
Evaluation of an Automated “Quick” Optimization Routine to Streamline Low-Flow LC-MS Setup
2024|Thermo Fisher Scientific|Posters
ThP 317 Evaluation of an Automated “Quick” Optimization Routine to Streamline Low-Flow LC-MS Setup Joshua A. Silveira, Gary A. Schultz, Matt Tsai, Katherine Walker, Hannah Snyder, Cornelia Boeser, Robert van Ling, Eloy R. Wouters, Thermo Fisher Scientific 355 River Oaks…
Key words
heatmaps, heatmapsdiagonal, diagonalemitter, emitterquick, quickoptimization, optimizationhctt, hcttspatial, spatialsingly, singlysheath, sheathroutines, routinesdoubly, doublyyielded, yieldedposition, positionroutine, routineexecutions
Complete Analytical Workflows for GLP-1 Receptor Agonists
2025|Agilent Technologies|Brochures and specifications
Agilent biopharma solutions Complete Analytical Workflows for GLP-1 Receptor Agonists Applications for peptide characterization, purification, and bioanalysis Contents Introduction 03 1 Identity, Purity, and Impurity Assessment 06 1.1 1.2 Introduction Molecular Weight Confirmation of a Peptide Using MS Spectral…
Key words
return, returnsection, sectioncontents, contentspeptide, peptidecounts, countsliraglutide, liraglutideoxidation, oxidationtirzepatide, tirzepatidesemaglutide, semaglutidemin, minmass, masstime, timeadvancebio, advancebiohaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgabundance
Identification of Amino Acid Isomers Using Electron Capture Dissociation in the Agilent 6545XT AdvanceBio LC/Q-TOF System
2024|Agilent Technologies|Applications
Application Note Biopharma Identification of Amino Acid Isomers Using Electron Capture Dissociation in the Agilent 6545XT AdvanceBio LC/Q-TOF System Authors Rachel Franklin and Joseph Meeuwsen Agilent Technologies, Inc. Abstract Accurately determining the amino acid sequence is crucial for understanding a…
Key words
fragmentation, fragmentationexd, exdisoasp, isoaspleu, leuecd, ecdile, ileelectron, electronisobaric, isobaricexdviewer, exdvieweramino, aminoside, sidecell, cellchain, chainreallyisodelightflk, reallyisodelightflktof