Quantification of Rituximab in Plasma Using an Automated and Standardized Kit-Based Approach
Applications | 2018 | WatersInstrumentation
Monoclonal antibodies (mAbs) have become a cornerstone in modern therapeutics, with projected global market values exceeding $138 billion. Accurate quantification of mAbs such as rituximab is critical for pharmacokinetic studies, biosimilar development and quality control in both research and clinical settings. However, conventional workflows involving affinity capture, enzymatic digestion and peptide clean-up are time-consuming and prone to variability, limiting throughput and reproducibility.
This study aimed to develop and validate a fully automated, kit-based workflow for the sensitive quantification of rituximab in plasma. By integrating standardized reagents and protocols with automated liquid handling, the approach sought to minimize manual intervention, streamline sample preparation and achieve a lower limit of quantification (LLOQ) of 0.1 µg/mL.
Rituximab was spiked into rat plasma and initially purified via Protein A affinity capture in a 96-well format. The eluate (equivalent to 28 µL plasma) underwent tryptic digestion using pre-measured reagents supplied in the ProteinWorks Auto-eXpress Low 5 Digest Kit. Following digestion, peptides were purified with the ProteinWorks µElution SPE Clean-Up Kit. All sample preparation steps were executed on a Hamilton Microlab STAR liquid handling platform. Peptide analysis was performed by UPLC-MS/MS using a Waters ACQUITY UPLC system coupled to a Xevo TQ-S triple-quadrupole mass spectrometer.
The automated protocol enabled complete affinity capture, digestion and SPE cleanup in under eight hours. Multiple rituximab signature peptides were monitored by MRM, delivering a linear detection range spanning over 3.5 logs. Standard curves exhibited coefficients of determination (r2) >0.99 and average accuracies between 100–102%. Quality control samples at low, mid and high concentrations showed mean accuracies within 88–114% and precision (%CV) consistently below 5%, meeting regulatory bioanalytical method validation guidelines. The robust performance highlights the method’s sensitivity, selectivity and reproducibility for mAb quantification.
Looking ahead, similar automated kit-based workflows may be extended to other therapeutic proteins and emerging modalities such as antibody–drug conjugates. Integration of multiplexed assays can enable simultaneous quantification of several mAbs in a single run. Further advances in liquid handling robotics, integrated data processing and AI-driven method optimization are expected to enhance throughput and analytical depth, meeting the growing demands of biologics research and development.
The combination of ProteinWorks Auto-eXpress digestion and µElution SPE kits with Hamilton STAR automation and Waters UPLC-MS/MS instrumentation provides a sensitive, reproducible and high-throughput solution for rituximab quantification in plasma. This streamlined approach reduces complexity, accelerates time to results and is accessible to inexperienced users, facilitating robust mAb bioanalysis across diverse applications.
Sample Preparation, LC/MS, LC/MS/MS, LC/QQQ
IndustriesClinical Research
ManufacturerWaters
Summary
Significance of the Topic
Monoclonal antibodies (mAbs) have become a cornerstone in modern therapeutics, with projected global market values exceeding $138 billion. Accurate quantification of mAbs such as rituximab is critical for pharmacokinetic studies, biosimilar development and quality control in both research and clinical settings. However, conventional workflows involving affinity capture, enzymatic digestion and peptide clean-up are time-consuming and prone to variability, limiting throughput and reproducibility.
Goals and Study Overview
This study aimed to develop and validate a fully automated, kit-based workflow for the sensitive quantification of rituximab in plasma. By integrating standardized reagents and protocols with automated liquid handling, the approach sought to minimize manual intervention, streamline sample preparation and achieve a lower limit of quantification (LLOQ) of 0.1 µg/mL.
Methodology and Instrumentation
Rituximab was spiked into rat plasma and initially purified via Protein A affinity capture in a 96-well format. The eluate (equivalent to 28 µL plasma) underwent tryptic digestion using pre-measured reagents supplied in the ProteinWorks Auto-eXpress Low 5 Digest Kit. Following digestion, peptides were purified with the ProteinWorks µElution SPE Clean-Up Kit. All sample preparation steps were executed on a Hamilton Microlab STAR liquid handling platform. Peptide analysis was performed by UPLC-MS/MS using a Waters ACQUITY UPLC system coupled to a Xevo TQ-S triple-quadrupole mass spectrometer.
Key Results and Discussion
The automated protocol enabled complete affinity capture, digestion and SPE cleanup in under eight hours. Multiple rituximab signature peptides were monitored by MRM, delivering a linear detection range spanning over 3.5 logs. Standard curves exhibited coefficients of determination (r2) >0.99 and average accuracies between 100–102%. Quality control samples at low, mid and high concentrations showed mean accuracies within 88–114% and precision (%CV) consistently below 5%, meeting regulatory bioanalytical method validation guidelines. The robust performance highlights the method’s sensitivity, selectivity and reproducibility for mAb quantification.
Benefits and Practical Applications
- Rapid turnaround: complete sample prep and data acquisition in a single workday.
- High sensitivity: LLOQ of 0.1 µg/mL for rituximab in plasma.
- Standardized reagents and protocols reduce method development time.
- Automation decreases hands-on time and minimizes human error.
- Scalable to high-throughput studies in discovery, preclinical and biosimilar research.
Future Trends and Possibilities
Looking ahead, similar automated kit-based workflows may be extended to other therapeutic proteins and emerging modalities such as antibody–drug conjugates. Integration of multiplexed assays can enable simultaneous quantification of several mAbs in a single run. Further advances in liquid handling robotics, integrated data processing and AI-driven method optimization are expected to enhance throughput and analytical depth, meeting the growing demands of biologics research and development.
Conclusion
The combination of ProteinWorks Auto-eXpress digestion and µElution SPE kits with Hamilton STAR automation and Waters UPLC-MS/MS instrumentation provides a sensitive, reproducible and high-throughput solution for rituximab quantification in plasma. This streamlined approach reduces complexity, accelerates time to results and is accessible to inexperienced users, facilitating robust mAb bioanalysis across diverse applications.
Instrumentation Used
- ProteinWorks Auto-eXpress Low 5 Digest Kit
- ProteinWorks µElution SPE Clean-Up Kit
- Hamilton Microlab STAR liquid handling workstation
- Waters ACQUITY UPLC Peptide BEH C18 Column (300 Å, 1.7 µm, 2.1 × 150 mm)
- Waters ACQUITY UPLC System
- Waters Xevo TQ-S triple-quadrupole mass spectrometer
References
- The Pharma Letter. Global Monoclonal Antibodies Market Set to Grow to $138.6 Billion by 2024. 2016.
- Biogen Idec. RITUXAN® (rituximab) US Package Insert. 2016.
- McKinsey & Company; Evaluate Pharma. US Patent Expiration Dates for Rituximab. 2018.
- US FDA. Guidance for Industry: Bioanalytical Method Validation, CDER. 2018.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
Automated and Standardized, Kit-Based Workflow for Protein Quantification
2018|Waters|Applications
[ TECHNOLOGY BRIEF ] Automated and Standardized, Kit-Based Workflow for Protein Quantification Mary Lame, Paula Orens, and Steven Calciano Waters Corporation, Milford, MA, USA Bottom-up, protein quantification workflows are time consuming and complex. A need exists for simpler and standardized…
Key words
proteinworks, proteinworkscrp, crpexpress, expressdigest, digestinfliximab, infliximabkits, kitsasqf, asqfafv, afvauto, autosins, sinsdill, dilllees, leesesd, esdautomated, automatedtryptic
Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma
2018|Waters|Applications
[ APPLICATION NOTE ] Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma Paula Orens, Mary Lame, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In 2015, the global…
Key words
cetuximab, cetuximabsqvffk, sqvffkdtlmisr, dtlmisrdilltqspvilsvspger, dilltqspvilsvspgerttppvldsdgsfflysk, ttppvldsdgsfflyskalpapiek, alpapiekyasesisgipsr, yasesisgipsrgpsvfplapssk, gpsvfplapsskproteinworks, proteinworkssilumab, silumabpark, parkpeptides, peptidessignature, signaturetryptic, trypticdigest
Waters Application Notes - ProteinWorks
2016|Waters|Guides
Waters Application Notes ProteinWorks OUR SCIENTISTS Erin E. Chambers As a principal scientist, Erin has been working almost exclusively on peptide and protein bioanalysis for the last seven years, while managing small and large molecule bioanalysis and clinical research applications…
Key words
proteinworks, proteinworksdigest, digestexpress, expressarea, areapeptide, peptidekit, kitgeneric, generictrastuzumab, trastuzumabplasma, plasmaftfsldtsk, ftfsldtskdigestion, digestionmurine, murineantibody, antibodyprotein, proteindstyslsstltlsk
AUTOMATED SAMPLE PREPARATION FOR HYBRID LC-MS/MS PROTEIN QUANTIFICATION
2020|Waters|Posters
AUTOMATED SAMPLE PREPARATION FOR HYBRID LC-MS/MS PROTEIN QUANTIFICATION Paula Orens and Mary Lame Waters Corporation, 34 Maple St Milford, MA 01757 INTRODUCTION METHODS Sample Preparation Whole Plasma Samples Using the Waters ProteinWorks™ (ProteinWorks) Auto-eXpress Direct Digest and µElution SPE CleanUp…
Key words
automated, automateddigestion, digestionpeptide, peptideetanercept, etanerceptdilltqspvilsvspger, dilltqspvilsvspgerproteinworks, proteinworksquantification, quantificationarea, areayase, yaseyasesisgipsr, yasesisgipsrprotein, proteinlinear, linearnormalized, normalizedsqvffk, sqvffkdill