Automated and Standardized, Kit-Based Workflow for Protein Quantification
Applications | 2018 | WatersInstrumentation
Protein quantification in biological matrices underpins many bioanalytical and clinical research workflows, but traditional bottom-up, enzymatic digestion methods are often laborious, time-consuming, and prone to variability. Implementing standardized, automated, kit-based approaches can enhance reproducibility, reduce human error, and accelerate method development.
This work evaluates a fully automated, kit-based sample preparation strategy using ProteinWorks™ Auto-eXpress Digest and µElution SPE Clean-Up Kits on a Hamilton Microlab® STAR liquid handler. The goal was to demonstrate accurate and reproducible quantification of C-reactive protein (CRP) and infliximab in rat plasma by LC-MS/MS with minimal manual intervention.
Further developments may include expansion to multiplexed protein panels, integration with robotics for end-to-end automation, and coupling with data-driven optimization tools. The generic kit approach could be extended to other complex matrices and biomarker classes, facilitating high-throughput protein bioanalysis.
A fully automated, kit-based sample preparation workflow on the Hamilton Microlab STAR, combined with Waters LC-MS/MS analysis, delivers accurate, reproducible, and robust protein quantification in plasma. This approach addresses key bottlenecks in bottom-up proteomics by standardizing digestion and cleanup, improving throughput, and minimizing variability.
Sample Preparation, Consumables, LC/MS, LC/MS/MS, LC/QQQ
IndustriesProteomics
ManufacturerWaters
Summary
Importance of Topic
Protein quantification in biological matrices underpins many bioanalytical and clinical research workflows, but traditional bottom-up, enzymatic digestion methods are often laborious, time-consuming, and prone to variability. Implementing standardized, automated, kit-based approaches can enhance reproducibility, reduce human error, and accelerate method development.
Study Objectives and Overview
This work evaluates a fully automated, kit-based sample preparation strategy using ProteinWorks™ Auto-eXpress Digest and µElution SPE Clean-Up Kits on a Hamilton Microlab® STAR liquid handler. The goal was to demonstrate accurate and reproducible quantification of C-reactive protein (CRP) and infliximab in rat plasma by LC-MS/MS with minimal manual intervention.
Methodology and Instrumentation
- Sample preparation: Direct digestion of 28 µL plasma aliquots with pre-measured reagents and universal protocol provided in the kits.
- Automation: Hamilton Microlab STAR programmed to perform digestion and peptide cleanup steps.
- Peptide purification: µElution SPE Clean-Up Kit integrated on the STAR for infliximab peptide cleanup.
- LC-MS/MS analysis: Waters ACQUITY™ UPLC with HSS T3 column and Xevo™ TQ-S triple quadrupole MS in MRM mode.
Main Results and Discussion
- Peptide area comparison: Automated digests yielded signature peptide areas within 25% of manual preparations across CRP and infliximab targets.
- Reproducibility: Intra-assay CVs ≤ 15% for all monitored peptides demonstrated excellent precision for both automated and manual workflows.
- Calibration performance: Linear standard curves (r2 > 0.99) over 1–250 µg/mL ranges, with mean accuracy between 98% and 111% for signature peptides.
- Quality control: QC samples at low, mid, and high levels showed mean accuracies of 90–110% and CVs generally below 10%, confirming method robustness.
Benefits and Practical Applications
- Streamlined workflow: Pre-measured, lot-traceable reagents and a universal protocol eliminate manual reagent handling and method tuning.
- Improved productivity: Automated liquid handling reduces hands-on time and frees skilled scientists for high-value tasks.
- Enhanced method transfer: Standardized kits and protocols simplify implementation across laboratories and operators.
Future Trends and Possibilities
Further developments may include expansion to multiplexed protein panels, integration with robotics for end-to-end automation, and coupling with data-driven optimization tools. The generic kit approach could be extended to other complex matrices and biomarker classes, facilitating high-throughput protein bioanalysis.
Conclusion
A fully automated, kit-based sample preparation workflow on the Hamilton Microlab STAR, combined with Waters LC-MS/MS analysis, delivers accurate, reproducible, and robust protein quantification in plasma. This approach addresses key bottlenecks in bottom-up proteomics by standardizing digestion and cleanup, improving throughput, and minimizing variability.
Used Instrumentation
- ProteinWorks™ Auto-eXpress Digest Kit and µElution SPE Clean-Up Kit (Waters Corporation)
- Hamilton Microlab® STAR automated liquid handler
- Waters ACQUITY™ UPLC HSS T3 column (2.1×50 mm, 1.8 µm)
- Xevo™ TQ-S triple quadrupole mass spectrometer
Reference
- Lame M., Orens P., Calciano S. Automated and Standardized, Kit-Based Workflow for Protein Quantification. Waters Corporation, 2018.
Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.
Similar PDF
AUTOMATED SAMPLE PREPARATION FOR HYBRID LC-MS/MS PROTEIN QUANTIFICATION
2020|Waters|Posters
AUTOMATED SAMPLE PREPARATION FOR HYBRID LC-MS/MS PROTEIN QUANTIFICATION Paula Orens and Mary Lame Waters Corporation, 34 Maple St Milford, MA 01757 INTRODUCTION METHODS Sample Preparation Whole Plasma Samples Using the Waters ProteinWorks™ (ProteinWorks) Auto-eXpress Direct Digest and µElution SPE CleanUp…
Key words
automated, automateddigestion, digestionpeptide, peptideetanercept, etanerceptdilltqspvilsvspger, dilltqspvilsvspgerproteinworks, proteinworksquantification, quantificationarea, areaprotein, proteinyasesisgipsr, yasesisgipsryase, yaselinear, linearnormalized, normalizedsqvffk, sqvffkdill
Quantification of Rituximab in Plasma Using an Automated and Standardized Kit-Based Approach
2018|Waters|Applications
[ APPLICATION NOTE ] Quantification of Rituximab in Plasma Using an Automated and Standardized Kit-Based Approach Mary Lame, Paula Orens, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In the past decade, monoclonal…
Key words
proteinworks, proteinworksrituximab, rituximabstandardized, standardizedglewigaiypgngdtsynqk, glewigaiypgngdtsynqkexpress, expressvdnalqsgnsqesvteqdsk, vdnalqsgnsqesvteqdskstar, starhamilton, hamiltondigest, digestmicrolab, microlabkit, kitquantification, quantificationplasma, plasmaautomated, automatedµelution
Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma
2018|Waters|Applications
[ APPLICATION NOTE ] Automated, Kit-Based Sample Preparation Strategy for LC-MS Quantification of Cetuximab in Rat Plasma Paula Orens, Mary Lame, and Steven Calciano Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automated and standardized approach In 2015, the global…
Key words
cetuximab, cetuximabsqvffk, sqvffkdtlmisr, dtlmisrdilltqspvilsvspger, dilltqspvilsvspgerttppvldsdgsfflysk, ttppvldsdgsfflyskalpapiek, alpapiekyasesisgipsr, yasesisgipsrgpsvfplapssk, gpsvfplapsskproteinworks, proteinworkssilumab, silumabpeptides, peptidespark, parksignature, signaturetryptic, trypticdigest
Sensitive and Reproducible LC-MS Quantification of C-Reactive Protein in Plasma: A Potential Biomarker of Inflammation
2016|Waters|Applications
[ APPLICATION NOTE ] Sensitive and Reproducible LC-MS Quantification of C-Reactive Protein in Plasma: A Potential Biomarker of Inflammation Paula Orens, Mary Lame, Steven Calciano, and Erin Chambers Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION High sensitivity quantification of…
Key words
esdtsyvslk, esdtsyvslkcrp, crpafvpfk, afvpfkafvfpk, afvfpkconcentration, concentrationendogenous, endogenouspeptide, peptidegysifsyatk, gysifsyatkmean, meanxevo, xevoplasma, plasmaoverspike, overspikecalculated, calculatedconfirmatory, confirmatorynote