ASMS 2021: 1©2021 Waters Corporation Download scientific posters at waters.com/posters Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway | LabRulez LCMS
 

Similar PDF

Toggle
[ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Routine BiopharmaceuticalAnalysis – AcceleratedACCESS | COMPLIANCE | QUALITY | EFFICIENCY [ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Improving lab efficiency without sacrificing results quality iscritical, but that isn’t easy. Now you can achieve high qualitydata while...
Key words
bioaccord, bioaccordpremier, premieracquity, acquitysystem, systemdata, datapennyk, pennykachieve, achievequality, qualitycompliant, compliantminimizing, minimizingconventional, conventionalmam, mammetal, metalproductive, productiveworkflows
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USINGAN LC-MS WITH A NOVEL INERT FLUDIC PATHWAYNilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin ChenWaters Corporation, 34 Maple street, MA, 01757, USAINTRODUCTION The Peptide Multi-Attribute Method (MAM) is an LC-MS assay...
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premieroxidation, oxidationsuccinamide, succinamidebioaccord, bioaccordpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqmam, mamacquity, acquityvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Application NoteThe BioAccord System With ACQUITYPremier for Improved Peptide CQAMonitoringNilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin ChenWaters CorporationAbstractPeptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that is increasingly usedin protein biotherapeutic quality assessment....
Key words
bioaccord, bioaccordhps, hpspremier, premiermaxpeak, maxpeaksurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performanceacidic, acidicsystem, systemattribute, attributemetal, metalaspartic, aspartictechnology
[ APPLICATION NOTEBOOK ]Multi-Attribute Methods forBiopharmaceutical AnalysisApplication Notes [ APPLICATION NOTEBOOK ]IntroductionThe adoption of LC-MS-based multi-attribute method (MAM) analysis for routine monitoringof biotherapeutic variation has progressed greatly over the last five years. The ability todirectly assess the molecular attributes that contribute...
Key words
notebook, notebookattribute, attributebiopharmaceutical, biopharmaceuticalreturn, returnmulti, multimam, mamapplication, applicationcontents, contentspeptide, peptideattributes, attributesmethods, methodsacquity, acquitymab, mabbioaccord, bioaccordmonitoring
 

Similar PDF

Toggle
[ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Routine BiopharmaceuticalAnalysis – AcceleratedACCESS | COMPLIANCE | QUALITY | EFFICIENCY [ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Improving lab efficiency without sacrificing results quality iscritical, but that isn’t easy. Now you can achieve high qualitydata while...
Key words
bioaccord, bioaccordpremier, premieracquity, acquitysystem, systemdata, datapennyk, pennykachieve, achievequality, qualitycompliant, compliantminimizing, minimizingconventional, conventionalmam, mammetal, metalproductive, productiveworkflows
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USINGAN LC-MS WITH A NOVEL INERT FLUDIC PATHWAYNilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin ChenWaters Corporation, 34 Maple street, MA, 01757, USAINTRODUCTION The Peptide Multi-Attribute Method (MAM) is an LC-MS assay...
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premieroxidation, oxidationsuccinamide, succinamidebioaccord, bioaccordpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqmam, mamacquity, acquityvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Application NoteThe BioAccord System With ACQUITYPremier for Improved Peptide CQAMonitoringNilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin ChenWaters CorporationAbstractPeptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that is increasingly usedin protein biotherapeutic quality assessment....
Key words
bioaccord, bioaccordhps, hpspremier, premiermaxpeak, maxpeaksurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performanceacidic, acidicsystem, systemattribute, attributemetal, metalaspartic, aspartictechnology
[ APPLICATION NOTEBOOK ]Multi-Attribute Methods forBiopharmaceutical AnalysisApplication Notes [ APPLICATION NOTEBOOK ]IntroductionThe adoption of LC-MS-based multi-attribute method (MAM) analysis for routine monitoringof biotherapeutic variation has progressed greatly over the last five years. The ability todirectly assess the molecular attributes that contribute...
Key words
notebook, notebookattribute, attributebiopharmaceutical, biopharmaceuticalreturn, returnmulti, multimam, mamapplication, applicationcontents, contentspeptide, peptideattributes, attributesmethods, methodsacquity, acquitymab, mabbioaccord, bioaccordmonitoring
 

Related content

Routine Determination of Trifluoroacetic Acid (TFA) and Difluoroacetic Acid (DFA) in Surface and Drinking Water by Direct Injection Using UPLC-MS/MS

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Environmental

Analysis of Multiclass Steroids in Serum Using Agilent Ultivo Triple Quadrupole LC/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Clinical Research

Efficient Method Development on Pharmaceutical Impurities Using Single Quadrupole Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

Identification of plastic additives in pharmaceutical packaging using a fully automated parallel extraction evaporator system and UHPLC-HRMS

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
Sample Preparation, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

How to prolong the lifetime of your HPLC column

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
Consumables, LC columns
Manufacturer
Thermo Fischer Scientific
Industries
---
 

Related content

Routine Determination of Trifluoroacetic Acid (TFA) and Difluoroacetic Acid (DFA) in Surface and Drinking Water by Direct Injection Using UPLC-MS/MS

Applications
| 2022 | Waters
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Waters
Industries
Environmental

Analysis of Multiclass Steroids in Serum Using Agilent Ultivo Triple Quadrupole LC/MS

Applications
| 2022 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Clinical Research

Efficient Method Development on Pharmaceutical Impurities Using Single Quadrupole Mass Spectrometer

Applications
| 2022 | Shimadzu
Instrumentation
LC/MS, LC/SQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

Identification of plastic additives in pharmaceutical packaging using a fully automated parallel extraction evaporator system and UHPLC-HRMS

Applications
| 2022 | Thermo Fischer Scientific
Instrumentation
Sample Preparation, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
Manufacturer
Thermo Fischer Scientific
Industries
Pharma & Biopharma

How to prolong the lifetime of your HPLC column

Technical notes
| 2022 | Thermo Fischer Scientific
Instrumentation
Consumables, LC columns
Manufacturer
Thermo Fischer Scientific
Industries
---
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.