Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway

Posters | 2021 | Waters | ASMSInstrumentation
LC/TOF, LC/HRMS, LC/MS
Industries
Proteomics
Manufacturer
Waters

Summary

Importance of the topic


Non-specific adsorption of acidic and metal-sensitive peptides to conventional LC fluidic pathways can compromise the sensitivity, accuracy and reproducibility of multi-attribute method (MAM) assays by causing sample loss, peak tailing and variable detector response. Addressing this challenge is essential for reliable quality control in biopharmaceutical development and manufacturing.

Study objectives and overview


This study compares MAM performance on two LC-MS configurations: a conventional stainless steel fluidic path and an advanced pathway featuring MaxPeak High Performance Surface (HPS) technology. The goal is to evaluate improvements in peptide recovery, assay reproducibility and new peak detection sensitivity when using the inert HPS fluidic path.

Used methodology and instrumentation


Samples of NISTmAb were analyzed under controlled and stress conditions using parallel workflows:
  • System 1: BioAccord™ UPLC/TOF MS with standard stainless steel fluidic path and ACQUITY UPLC Peptide CSH C18 column (p/n 186006938).
  • System 2: BioAccord UPLC/TOF MS paired with ACQUITY Premier UPLC and MaxPeak™ HPS fluidic path, using ACQUITY Premier Peptide CSH C18 column (p/n 186009489).
  • Mobile phases: Water/0.1% FA (A) and Acetonitrile/0.1% FA (B); gradient from 1% to 85% B over 100 min at 0.2 mL/min.
  • MS settings: ESI+ ionization, m/z 50–2000, capillary voltage 1.2 kV, cone voltage 20 V, collision energy 60–120 V.

Main results and discussion


Comparison of peptide attributes and new peak detection revealed:
  • Acidic peptide recovery (GFYPSDIAVEWESNGQPENNYK and deamidated forms) increased significantly on the HPS system, with more symmetrical peaks and higher base peak intensities.
  • Relative standard deviation (%RSD) for critical quality attribute (CQA) measurements was reduced or comparable on the HPS pathway, indicating improved assay precision.
  • New peak detection sensitivity, assessed by %base peak response for an oxidation peptide (DMIFNFYFDVWGQGTTVTVSSASTK), more than doubled on System 2, demonstrating enhanced detection of low-level modifications.

Benefits and practical application


The integration of MaxPeak HPS fluidic technology into the BioAccord LC-MS platform yields:
  • Improved peptide recovery and chromatographic performance for metal-sensitive analytes.
  • Enhanced reproducibility and lower variability in quantitative MAM assays.
  • Greater sensitivity for new peak detection, supporting robust monitoring of biotherapeutic modifications.

Future trends and opportunities


Advancements in inert fluidic pathway materials and surface chemistries are expected to further reduce adsorption effects and extend the applicability of MAM workflows. Integration with high-resolution MS and automation could enable fully unattended, high-throughput characterization of complex biologics in development and QC environments.

Conclusion


The use of MaxPeak HPS technology in LC-MS multi-attribute methods significantly mitigates non-specific adsorption, enhances peptide recovery, improves assay precision and increases sensitivity for detecting low-level modifications. The BioAccord platform with ACQUITY Premier UPLC and HPS fluidics offers a robust, flexible solution for biopharmaceutical analytics across R&D and quality operations.

Reference


  • Ranbaduge N., Birdsall R.E., Yu Y.Q., Chen W. Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway. Waters Corporation, 2021.

Content was automatically generated from an orignal PDF document using AI and may contain inaccuracies.

Downloadable PDF for viewing
 

Similar PDF

Toggle
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY Nilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin Chen Waters Corporation, 34 Maple street, MA, 01757, USA INTRODUCTION  The Peptide Multi-Attribute Method…
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngksuccinamide, succinamidebioaccord, bioaccordpremier, premieroxidation, oxidationpennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqacquity, acquitymam, mamvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
The BioAccord System With ACQUITY  Premier for Improved Peptide CQA  Monitoring
Application Note The BioAccord System With ACQUITY Premier for Improved Peptide CQA Monitoring Nilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin Chen Waters Corporation Abstract Peptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that…
Key words
bioaccord, bioaccordhps, hpsmaxpeak, maxpeakpremier, premiersurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performanceacidic, acidicsystem, systemaspartic, asparticattribute, attributetechnology, technologyassay
Peptide Mapping for Biotherapeutics
Peptide Mapping for Biotherapeutics Strategies for Simplifying Protein Digestion A sponsored publication from Peptide Mapping Doesn’t Need to Be Complex Introducing PeptideWorks™ Tryptic Protein Digestion Kits PeptideWorks Tryptic Protein Digestion Kits uniquely deliver automatable, high efficiency, reproducible peptide maps in…
Key words
peptide, peptidetrypsin, trypsinmapping, mappingdigestion, digestionrapizyme, rapizymehps, hpsmaxpeak, maxpeakacquity, acquityprotein, proteinpeptideworks, peptideworkspremier, premiercqa, cqatryptic, trypticproteins, proteinscan
Multi-Attribute Methods for Biopharmaceutical Analysis
[ APPLICATION NOTEBOOK ] Multi-Attribute Methods for Biopharmaceutical Analysis Application Notes [ APPLICATION NOTEBOOK ] Introduction The adoption of LC-MS-based multi-attribute method (MAM) analysis for routine monitoring of biotherapeutic variation has progressed greatly over the last five years. The ability…
Key words
notebook, notebookattribute, attributebiopharmaceutical, biopharmaceuticalreturn, returnmulti, multimam, mamapplication, applicationcontents, contentspeptide, peptideattributes, attributesmethods, methodsacquity, acquitymab, mabbioaccord, bioaccordmonitoring
Other projects
GCMS
ICPMS
Follow us
FacebookX (Twitter)LinkedInYouTube
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike