LCMS
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike
 

Similar PDF

Toggle
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USING AN LC-MS WITH A NOVEL INERT FLUDIC PATHWAY Nilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin Chen Waters Corporation, 34 Maple street, MA, 01757, USA INTRODUCTION  The Peptide Multi-Attribute Method…
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premierbioaccord, bioaccordoxidation, oxidationsuccinamide, succinamidepennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykgfypsdiavewesngq, gfypsdiavewesngqacquity, acquitymam, mamvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Application Note The BioAccord System With ACQUITY Premier for Improved Peptide CQA Monitoring Nilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin Chen Waters Corporation Abstract Peptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that…
Key words
bioaccord, bioaccordhps, hpspremier, premiermaxpeak, maxpeaksurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performanceacidic, acidicsystem, systemattribute, attributeaspartic, aspartictechnology, technologyassay
[ BIOACCORD SYSTEM WITH ACQUITY PREMIER ] Routine Biopharmaceutical Analysis – Accelerated ACCESS | COMPLIANCE | QUALITY | EFFICIENCY [ BIOACCORD SYSTEM WITH ACQUITY PREMIER ] Improving lab efficiency without sacrificing results quality is critical, but that isn’t easy. Now…
Key words
bioaccord, bioaccordpremier, premieracquity, acquitysystem, systemdata, datapennyk, pennykachieve, achievequality, qualitycompliant, compliantminimizing, minimizingconventional, conventionalmam, mamproductive, productiveworkflows, workflowshps
[ APPLICATION NOTEBOOK ] Multi-Attribute Methods for Biopharmaceutical Analysis Application Notes [ APPLICATION NOTEBOOK ] Introduction The adoption of LC-MS-based multi-attribute method (MAM) analysis for routine monitoring of biotherapeutic variation has progressed greatly over the last five years. The ability…
Key words
notebook, notebookattribute, attributebiopharmaceutical, biopharmaceuticalreturn, returnmulti, multimam, mamapplication, applicationcontents, contentspeptide, peptideattributes, attributesmethods, methodsacquity, acquitymab, mabbioaccord, bioaccordmonitoring
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use
LabRulez s.r.o. All rights reserved. Content available under a CC BY-SA 4.0 Attribution-ShareAlike