ASMS 2021: 1©2021 Waters Corporation Download scientific posters at waters.com/posters Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway Posters | 2021 | WatersInstrumentation
LC/TOF, LC/HRMS, LC/MS
Industries
Proteomics
Manufacturer
Waters
Key words

 

Similar PDF

Toggle
Application NoteIncreasing Chromatographic Performance ofAcidic Peptides in RPLC-MS-based Assayswith ACQUITY PREMIER featuring MaxPeakHPS TechnologyRobert E. Birdsall, Jacob Kellet, Samantha Ippoliti, Nilini Ranbaduge, Henry Shion,Ying Qing YuWaters Corporation AbstractMetal-ion mediated adsorption of analytes as a contributing factor in poor peak shape, tailing,...
Key words
maxpeak, maxpeakhps, hpspremier, premieracquity, acquitypeptide, peptidetechnology, technologytailing, tailingincreased, increasedcan, canacid, acidassay, assaynative, nativerplc, rplcdrug, drugchromatographic
[ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Routine BiopharmaceuticalAnalysis – AcceleratedACCESS | COMPLIANCE | QUALITY | EFFICIENCY [ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Improving lab efficiency without sacrificing results quality iscritical, but that isn’t easy. Now you can achieve high qualitydata while...
Key words
bioaccord, bioaccordpremier, premieracquity, acquitysystem, systemdata, datapennyk, pennykachieve, achievequality, qualitycompliant, compliantconventional, conventionalminimizing, minimizingmam, mamhps, hpsproductive, productivemetal
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USINGAN LC-MS WITH A NOVEL INERT FLUDIC PATHWAYNilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin ChenWaters Corporation, 34 Maple street, MA, 01757, USAINTRODUCTION The Peptide Multi-Attribute Method (MAM) is an LC-MS assay...
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premierbioaccord, bioaccordoxidation, oxidationsuccinamide, succinamidepennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykmam, mamgfypsdiavewesngq, gfypsdiavewesngqacquity, acquityvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Application NoteThe BioAccord System With ACQUITYPremier for Improved Peptide CQAMonitoringNilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin ChenWaters CorporationAbstractPeptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that is increasingly usedin protein biotherapeutic quality assessment....
Key words
bioaccord, bioaccordpremier, premierhps, hpsmaxpeak, maxpeaksurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performanceacidic, acidicsystem, systemattribute, attributeassay, assaymetal, metalaspartic

ASMS 2021: 1©2021 Waters Corporation Download scientific posters at waters.com/posters Improving Multi-Attribute Method using LC-MS System with Novel Inert Fluidic Pathway Posters | 2021 | WatersInstrumentation
LC/TOF, LC/HRMS, LC/MS
Industries
Proteomics
Manufacturer
Waters
Key words

 

Similar PDF

Toggle
Application NoteIncreasing Chromatographic Performance ofAcidic Peptides in RPLC-MS-based Assayswith ACQUITY PREMIER featuring MaxPeakHPS TechnologyRobert E. Birdsall, Jacob Kellet, Samantha Ippoliti, Nilini Ranbaduge, Henry Shion,Ying Qing YuWaters Corporation AbstractMetal-ion mediated adsorption of analytes as a contributing factor in poor peak shape, tailing,...
Key words
maxpeak, maxpeakhps, hpspremier, premieracquity, acquitypeptide, peptidetechnology, technologytailing, tailingincreased, increasedcan, canacid, acidassay, assaynative, nativerplc, rplcdrug, drugchromatographic
[ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Routine BiopharmaceuticalAnalysis – AcceleratedACCESS | COMPLIANCE | QUALITY | EFFICIENCY [ BIOACCORD SYSTEM WITH ACQUITY PREMIER ]Improving lab efficiency without sacrificing results quality iscritical, but that isn’t easy. Now you can achieve high qualitydata while...
Key words
bioaccord, bioaccordpremier, premieracquity, acquitysystem, systemdata, datapennyk, pennykachieve, achievequality, qualitycompliant, compliantconventional, conventionalminimizing, minimizingmam, mamhps, hpsproductive, productivemetal
IMPROVING PERFORMANCE OF MULTI-ATTRUBUTE METHOD ASSAYS USINGAN LC-MS WITH A NOVEL INERT FLUDIC PATHWAYNilini Ranbaduge, Robert Birdsall, Scott Berger, Ying Qing Yu, Weibin ChenWaters Corporation, 34 Maple street, MA, 01757, USAINTRODUCTION The Peptide Multi-Attribute Method (MAM) is an LC-MS assay...
Key words
eeqynstyr, eeqynstyrvvsvltvlhqdwlngk, vvsvltvlhqdwlngkpremier, premierbioaccord, bioaccordoxidation, oxidationsuccinamide, succinamidepennyk, pennykdeamidation, deamidationgfypsdiavewesngqpennyk, gfypsdiavewesngqpennykmam, mamgfypsdiavewesngq, gfypsdiavewesngqacquity, acquityvtnmdpadtatyycar, vtnmdpadtatyycardiqmtqspstlsasvgdr, diqmtqspstlsasvgdrassay
Application NoteThe BioAccord System With ACQUITYPremier for Improved Peptide CQAMonitoringNilini Ranbaduge, Robert E. Birdsall, Ying Qing Yu, Weibin ChenWaters CorporationAbstractPeptide MAM is an LC-MS based assay for direct biotherapeutic product attribute analysis that is increasingly usedin protein biotherapeutic quality assessment....
Key words
bioaccord, bioaccordpremier, premierhps, hpsmaxpeak, maxpeaksurfaces, surfacesmam, mamacquity, acquitypeptide, peptideperformance, performanceacidic, acidicsystem, systemattribute, attributeassay, assaymetal, metalaspartic
 

Related content

Waters Atlantis Premier BEH Z-HILIC Columns

Brochures and specifications
| 2021 | Waters
Instrumentation
Consumables, LC columns
Manufacturer
Waters
Industries
---

Simultaneous Quantification of Multiclass PFAS in Biosolids Using a Single Extraction Method and the Agilent 6495 Triple Quadrupole LC/MS

Applications
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

Quantitative Determination of NDMA Impurity in Ranitidine Drug Products – Examples of Actual Samples Analysis by LCMS-8060 with APCI

Applications
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

It’s Not All About the Column: The Role of the Mobile Phase and Your Instrument

Presentations
| 2021 | Agilent Technologies
Instrumentation
Consumables, HPLC
Manufacturer
Agilent Technologies
Industries
---

Improved Separation of RNA Nucleotides, Nucleosides, and Nucleobases on Atlantis Premier BEH Z-HILIC Columns

Applications
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research
 

Related content

Waters Atlantis Premier BEH Z-HILIC Columns

Brochures and specifications
| 2021 | Waters
Instrumentation
Consumables, LC columns
Manufacturer
Waters
Industries
---

Simultaneous Quantification of Multiclass PFAS in Biosolids Using a Single Extraction Method and the Agilent 6495 Triple Quadrupole LC/MS

Applications
| 2021 | Agilent Technologies
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Agilent Technologies
Industries
Environmental

Quantitative Determination of NDMA Impurity in Ranitidine Drug Products – Examples of Actual Samples Analysis by LCMS-8060 with APCI

Applications
| 2021 | Shimadzu
Instrumentation
LC/MS, LC/MS/MS, LC/QQQ
Manufacturer
Shimadzu
Industries
Pharma & Biopharma

It’s Not All About the Column: The Role of the Mobile Phase and Your Instrument

Presentations
| 2021 | Agilent Technologies
Instrumentation
Consumables, HPLC
Manufacturer
Agilent Technologies
Industries
---

Improved Separation of RNA Nucleotides, Nucleosides, and Nucleobases on Atlantis Premier BEH Z-HILIC Columns

Applications
| 2021 | Waters
Instrumentation
Consumables, LC/MS, LC/MS/MS, LC columns, LC/QQQ
Manufacturer
Waters
Industries
Clinical Research
Other projects
Follow us
More information
WebinarsAbout usContact usTerms of use

LabRulez s.r.o., all rights reserved.